dbPTM

CD79B_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CD79B_MOUSE
UniProt AC	P15530
Protein Name	B-cell antigen receptor complex-associated protein beta chain
Gene Name	Cd79b
Organism	Mus musculus (Mouse).
Sequence Length	228
Subcellular Localization	Cell membrane Single-pass type I membrane protein . Following antigen binding, the BCR has been shown to translocate from detergent-soluble regions of the cell membrane to lipid rafts although signal transduction through the complex can also occur
Protein Description	Required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation..
Protein Sequence	MATLVLSSMPCHWLLFLLLLFSGEPVPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKDGIILIQTLLIILFIIVPIFLLLDKDDGKAGMEEDHTYEGLNIDQTATYEDIVTLRTGEVKWSVGEHPGQE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
68	N-linked_Glycosylation	VKFHCYTNHSGALTW EEEEEECCCCCCEEH	10.80	-
99	N-linked_Glycosylation	GRIVQTQNGSVYTLT CCEEECCCCCEEEEE	48.36	-
130	N-linked_Glycosylation	KCDSANHNVTDSCGT ECCCCCCCCCCCCCC	37.89	-
194	Phosphorylation	AGMEEDHTYEGLNID CCCCCCCCCCCCCCC	35.27	24224561
195	Phosphorylation	GMEEDHTYEGLNIDQ CCCCCCCCCCCCCCC	12.46	24224561
206	Phosphorylation	NIDQTATYEDIVTLR CCCCCEEECCEEEEE	14.78	24224561
218	Ubiquitination	TLRTGEVKWSVGEHP EEECCCEEEECCCCC	29.46	-
220	Phosphorylation	RTGEVKWSVGEHPGQ ECCCEEEECCCCCCC	17.96	21189417

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
195	Y	Phosphorylation	Kinase	FYN	P06241	PSP
195	Y	Phosphorylation	Kinase	LYN	P07948	PSP
195	Y	Phosphorylation	Kinase	SRC-FAMILY	-	GPS
195	Y	Phosphorylation	Kinase	SRC-TYPE TYR-KINASES	-	Uniprot
206	Y	Phosphorylation	Kinase	SRC-FAMILY	-	GPS
206	Y	Phosphorylation	Kinase	SRC-TYPE TYR-KINASES	-	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CD79B_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CD79B_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of CD79B_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CD79B_MOUSE

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Reconstitution of the B cell antigen receptor signaling components inCOS cells."; Saouaf S.J., Kut S.A., Fargnoli J., Rowley R.B., Bolen J.B.,Mahajan S.; J. Biol. Chem. 270:27072-27078(1995). Cited for: INTERACTION WITH BLK, AND PHOSPHORYLATION AT TYR-195 AND TYR-206.	7592958 [Abstract]