CD5R1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CD5R1_MOUSE
• UniProt AC: P61809
• Protein Name: Cyclin-dependent kinase 5 activator 1
• Gene Name: Cdk5r1
• Organism: Mus musculus (Mouse).
• Sequence Length: 307
• Subcellular Localization: Cyclin-dependent kinase 5 activator 1, p35: Cell membrane; Lipid-anchor; Cytoplasmic side.; Cyclin-dependent kinase 5 activator 1, p25: Nucleus. Cytoplasm, perinuclear region. The conversion of p35 to p25 relocalizes the protein from the cell periphe
• Protein Description: p35 is a neuron specific activator of CDK5. The complex p35/CDK5 is required for neurite outgrowth and cortical lamination. Involved in dendritic spine morphogenesis by mediating the EFNA1-EPHA4 signaling. Activator of TPKII. The complex p35/CDK5 participates in the regulation of the circadian clock by modulating the function of CLOCK protein: phosphorylates CLOCK at 'Thr-451' and 'Thr-461' and regulates the transcriptional activity of the CLOCK-ARNTL/BMAL1 heterodimer in association with altered stability and subcellular distribution..
• Protein Sequence: MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKAQPNSSYQSNIAHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGVSSSVKKAPHPAITSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Myristoylation	------MGTVLSLSP ------CCCEEECCH	25.24	-
6	Phosphorylation	--MGTVLSLSPSYRK --CCCEEECCHHHCC	23.59	-
8	Phosphorylation	MGTVLSLSPSYRKAT CCCEEECCHHHCCEE	14.39	20097924
33	Phosphorylation	HYTAVQNSKNAKDKN HHHHHCCCCCCCCCC	15.36	22817900
45	Phosphorylation	DKNLKRHSIISVLPW CCCCCCCCEEEECCH	26.17	29899451
59	Phosphorylation	WKRIVAVSAKKKNSK HHHHEEEEECCCCCC	25.32	29899451
91	Phosphorylation	ENLKKSLSCANLSTF CHHHHHHCCCCHHHC	20.48	20097924
112	Phosphorylation	QPPAPPASQLSGSQT CCCCCCHHHCCCCCC	37.11	29899451
122	Phosphorylation	SGSQTGVSSSVKKAP CCCCCCCCCCCCCCC	20.45	29899451
134	Phosphorylation	KAPHPAITSAGTPKR CCCCCCCCCCCCCCE	18.03	22324799
135	Phosphorylation	APHPAITSAGTPKRV CCCCCCCCCCCCCEE	20.70	22324799
138	Phosphorylation	PAITSAGTPKRVIVQ CCCCCCCCCCEEEEE	25.92	22324799

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
8	S	Phosphorylation	Kinase	CDK5	P49615	Uniprot
33	S	Phosphorylation	Kinase	PRKCZ	Q05513	GPS
91	S	Phosphorylation	Kinase	SIK2	Q8CFH6	GPS
138	T	Phosphorylation	Kinase	CDK5	P49615	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
8	S	Phosphorylation	Phosphorylation at Ser-8 and Thr-138 by CDK5 prevents calpain-mediated proteolysis.	-
138	T	Phosphorylation	Phosphorylation at Ser-8 and Thr-138 by CDK5 prevents calpain-mediated proteolysis.	-

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CD5R1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SDS3_MOUSE	Suds3	physical	15489224

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.