CD3E_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CD3E_MOUSE
• UniProt AC: P22646
• Protein Name: T-cell surface glycoprotein CD3 epsilon chain
• Gene Name: Cd3e
• Organism: Mus musculus (Mouse).
• Sequence Length: 189
• Subcellular Localization: Cell membrane ; Single-pass type I membrane protein .
• Protein Description: Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell developement. [PubMed: 19956738]
• Protein Sequence: MRWNTFWGILCLSLLAVGTCQDDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVDLTAVAIIIIVDICITLGLLMVIYYWSKNRKAKAKPVTRGTGAGSRPRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRAV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
152	Phosphorylation	TRGTGAGSRPRGQNK CCCCCCCCCCCCCCC	38.28	25266776
159	Ubiquitination	SRPRGQNKERPPPVP CCCCCCCCCCCCCCC	47.41	-
170	Phosphorylation	PPVPNPDYEPIRKGQ CCCCCCCCCCCCCCC	25.51	20438120
181	Phosphorylation	RKGQRDLYSGLNQRA CCCCCCCCCCCHHCC	12.65	20438120

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
170	Y	Phosphorylation	Kinase	FYN	P39688	PSP
181	Y	Phosphorylation	Kinase	FYN	P39688	PSP

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CD3E_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CD3E_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SHC1_HUMAN	SHC1	physical	11855827
LCK_HUMAN	LCK	physical	11855827
ZAP70_HUMAN	ZAP70	physical	11855827
PTN6_MOUSE	Ptpn6	physical	9064344

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.