UniProt ID | CD3E_MOUSE | |
---|---|---|
UniProt AC | P22646 | |
Protein Name | T-cell surface glycoprotein CD3 epsilon chain | |
Gene Name | Cd3e | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 189 | |
Subcellular Localization |
Cell membrane Single-pass type I membrane protein . |
|
Protein Description | Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell developement. [PubMed: 19956738] | |
Protein Sequence | MRWNTFWGILCLSLLAVGTCQDDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVDLTAVAIIIIVDICITLGLLMVIYYWSKNRKAKAKPVTRGTGAGSRPRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRAV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
152 | Phosphorylation | TRGTGAGSRPRGQNK CCCCCCCCCCCCCCC | 38.28 | 25266776 | |
159 | Ubiquitination | SRPRGQNKERPPPVP CCCCCCCCCCCCCCC | 47.41 | - | |
170 | Phosphorylation | PPVPNPDYEPIRKGQ CCCCCCCCCCCCCCC | 25.51 | 20438120 | |
181 | Phosphorylation | RKGQRDLYSGLNQRA CCCCCCCCCCCHHCC | 12.65 | 20438120 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CD3E_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CD3E_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SHC1_HUMAN | SHC1 | physical | 11855827 | |
LCK_HUMAN | LCK | physical | 11855827 | |
ZAP70_HUMAN | ZAP70 | physical | 11855827 | |
PTN6_MOUSE | Ptpn6 | physical | 9064344 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...