UniProt ID | CD046_HUMAN | |
---|---|---|
UniProt AC | Q504U0 | |
Protein Name | Renal cancer differentiation gene 1 protein {ECO:0000303|PubMed:25059753} | |
Gene Name | C4orf46 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 113 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | ||
Protein Sequence | MADPEELQVSSPPPPPPSSPSSSDASAASSPGGPVSLGWPVPSRSSGPTVDQLEEVELQIGDAAFSLTKLLEATSAVSAQVEELAFKCTENARFLKTWRDLLKEGYDSLKPDD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Phosphorylation | DPEELQVSSPPPPPP CHHHCCCCCCCCCCC | 24.94 | 28348404 | |
11 | Phosphorylation | PEELQVSSPPPPPPS HHHCCCCCCCCCCCC | 42.44 | 28348404 | |
18 | Phosphorylation | SPPPPPPSSPSSSDA CCCCCCCCCCCCCCC | 61.73 | 28348404 | |
19 | Phosphorylation | PPPPPPSSPSSSDAS CCCCCCCCCCCCCCH | 34.28 | 28348404 | |
21 | Phosphorylation | PPPPSSPSSSDASAA CCCCCCCCCCCCHHH | 44.41 | 28348404 | |
22 | Phosphorylation | PPPSSPSSSDASAAS CCCCCCCCCCCHHHC | 35.30 | 28348404 | |
23 | Phosphorylation | PPSSPSSSDASAASS CCCCCCCCCCHHHCC | 41.35 | 28348404 | |
26 | Phosphorylation | SPSSSDASAASSPGG CCCCCCCHHHCCCCC | 29.38 | 26074081 | |
29 | Phosphorylation | SSDASAASSPGGPVS CCCCHHHCCCCCCCC | 36.46 | 26074081 | |
30 | Phosphorylation | SDASAASSPGGPVSL CCCHHHCCCCCCCCC | 23.88 | 26074081 | |
36 | Phosphorylation | SSPGGPVSLGWPVPS CCCCCCCCCCCCCCC | 25.05 | 26074081 | |
87 | Ubiquitination | QVEELAFKCTENARF HHHHHHHHHHHHHHH | 34.34 | 29967540 | |
96 | Ubiquitination | TENARFLKTWRDLLK HHHHHHHHHHHHHHH | 43.24 | - | |
103 | Ubiquitination | KTWRDLLKEGYDSLK HHHHHHHHHCHHHCC | 57.29 | - | |
110 | Ubiquitination | KEGYDSLKPDD---- HHCHHHCCCCC---- | 50.80 | 24816145 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CD046_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CD046_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CD046_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...