| UniProt ID | CD046_HUMAN | |
|---|---|---|
| UniProt AC | Q504U0 | |
| Protein Name | Renal cancer differentiation gene 1 protein {ECO:0000303|PubMed:25059753} | |
| Gene Name | C4orf46 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 113 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | ||
| Protein Sequence | MADPEELQVSSPPPPPPSSPSSSDASAASSPGGPVSLGWPVPSRSSGPTVDQLEEVELQIGDAAFSLTKLLEATSAVSAQVEELAFKCTENARFLKTWRDLLKEGYDSLKPDD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 10 | Phosphorylation | DPEELQVSSPPPPPP CHHHCCCCCCCCCCC | 24.94 | 28348404 | |
| 11 | Phosphorylation | PEELQVSSPPPPPPS HHHCCCCCCCCCCCC | 42.44 | 28348404 | |
| 18 | Phosphorylation | SPPPPPPSSPSSSDA CCCCCCCCCCCCCCC | 61.73 | 28348404 | |
| 19 | Phosphorylation | PPPPPPSSPSSSDAS CCCCCCCCCCCCCCH | 34.28 | 28348404 | |
| 21 | Phosphorylation | PPPPSSPSSSDASAA CCCCCCCCCCCCHHH | 44.41 | 28348404 | |
| 22 | Phosphorylation | PPPSSPSSSDASAAS CCCCCCCCCCCHHHC | 35.30 | 28348404 | |
| 23 | Phosphorylation | PPSSPSSSDASAASS CCCCCCCCCCHHHCC | 41.35 | 28348404 | |
| 26 | Phosphorylation | SPSSSDASAASSPGG CCCCCCCHHHCCCCC | 29.38 | 26074081 | |
| 29 | Phosphorylation | SSDASAASSPGGPVS CCCCHHHCCCCCCCC | 36.46 | 26074081 | |
| 30 | Phosphorylation | SDASAASSPGGPVSL CCCHHHCCCCCCCCC | 23.88 | 26074081 | |
| 36 | Phosphorylation | SSPGGPVSLGWPVPS CCCCCCCCCCCCCCC | 25.05 | 26074081 | |
| 87 | Ubiquitination | QVEELAFKCTENARF HHHHHHHHHHHHHHH | 34.34 | 29967540 | |
| 96 | Ubiquitination | TENARFLKTWRDLLK HHHHHHHHHHHHHHH | 43.24 | - | |
| 103 | Ubiquitination | KTWRDLLKEGYDSLK HHHHHHHHHCHHHCC | 57.29 | - | |
| 110 | Ubiquitination | KEGYDSLKPDD---- HHCHHHCCCCC---- | 50.80 | 24816145 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CD046_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CD046_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CD046_HUMAN !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...