dbPTM

CCU11_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CCU11_ARATH
UniProt AC	Q9LJ45
Protein Name	Cyclin-U1-1
Gene Name	CYCU1-1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	210
Subcellular Localization
Protein Description
Protein Sequence	MLTAAGDDELDPVVGPESATEAATPRVLTIISHVMEKLVARNEWLAKQTKGFGKSLEAFHGVRAPSISIAKYLERIYKYTKCSPACFVVGYVYIDRLAHKHPGSLVVSLNVHRLLVTCVMIAAKILDDVHYNNEFYARVGGVSNADLNKMELELLFLLDFRVTVSFRVFESYCFHLEKEMQLNDAVSSLKDIQPMQESLSPASTLSSLYV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of CCU11_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CCU11_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CCU11_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CCU11_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDKA1_ARATH	CDC2	physical	24951878
CKB21_ARATH	CDKB2;1	physical	24951878
CKB22_ARATH	CDKB2;2	physical	24951878

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CCU11_ARATH

Related Literatures of Post-Translational Modification