CCT13_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CCT13_ARATH
• UniProt AC: Q8LBC0
• Protein Name: Cyclin-T1-3
• Gene Name: CYCT1-3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 317
• Protein Sequence: MGEEHPRKRSRQHFEAEARNVSLFESPQCETSKWYFSREEIERFSPSRKDGIDLVKESFLRSSYCTFLQRLGMKLHVSQVTISCAMVMCHRFYMRQSHAKNDWQTIATSSLFLACKAEDEPCQLSSVVVASYEIIYEWDPSASIRIHQTECYHEFKEIILSGESLLLSTSAFHLDIELPYKPLAAALNRLNAWPDLATAAWNFVHDWIRTTLCLQYKPHVIATATVHLAATFQNAKVGSRRDWWLEFGVTTKLLKEVIQEMCTLIEVDRRRNMPPPPPPPRRELSWAIPAAVKPVHMARAYPFHSYPLQSYRQAGIW

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
45	Phosphorylation	REEIERFSPSRKDGI HHHHHHHCCCCCCCH	28.34	24243849

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CCT13_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CCT13_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CCT13_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDKC1_ARATH	CDKC;1	physical	20706207
CDKC2_ARATH	CDKC2	physical	20706207

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.