| UniProt ID | CCNH_MOUSE | |
|---|---|---|
| UniProt AC | Q61458 | |
| Protein Name | Cyclin-H | |
| Gene Name | Ccnh | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 323 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Regulates CDK7, the catalytic subunit of the CDK-activating kinase (CAK) enzymatic complex. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminal domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Involved in cell cycle control and in RNA transcription by RNA polymerase II. Its expression and activity are constant throughout the cell cycle.. | |
| Protein Sequence | MYHSSSQKRHWTFASEEQLARLRADANRKFKCKAVANGKVLPNDPVFLEPHEELTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQERALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDIKTRYPMLENPEILRKTADDFLSRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSDEVAVLKQKLERCHSSDLALNAVTKKRKGYEDDDYVSKKPKQEEEEWTDDDLVDSL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Phosphorylation | ---MYHSSSQKRHWT ---CCCCCCCCCCCC | 24.39 | 15851034 | |
| 132 | Phosphorylation | FVGNLRESPLGQERA HHCCCCCCCCCHHHH | 20.99 | 26824392 | |
| 189 | Ubiquitination | ENPEILRKTADDFLS CCHHHHHHHHHHHHH | 44.62 | - | |
| 261 | Acetylation | SMRNLVKKYEPPRSD HHHHHHHHHCCCCCC | 47.57 | 7744217 | |
| 302 | Phosphorylation | KGYEDDDYVSKKPKQ CCCCCCCCCCCCCCH | 17.39 | 25159016 | |
| 304 | Phosphorylation | YEDDDYVSKKPKQEE CCCCCCCCCCCCHHH | 28.82 | 25159016 | |
| 315 | Phosphorylation | KQEEEEWTDDDLVDS CHHHCCCCCCHHHHC | 32.60 | 27087446 | |
| 322 | Phosphorylation | TDDDLVDSL------ CCCHHHHCC------ | 28.62 | 25619855 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CCNH_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CCNH_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CDK7_MOUSE | Cdk7 | physical | 11319144 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...