CCL3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CCL3_HUMAN
• UniProt AC: P10147
• Protein Name: C-C motif chemokine 3
• Gene Name: CCL3
• Organism: Homo sapiens (Human).
• Sequence Length: 92
• Subcellular Localization: Secreted.
• Protein Description: Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV)..
• Protein Sequence: MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
86	Phosphorylation	EWVQKYVSDLELSA- HHHHHHHHHHCCCC-	33.13	28348404

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CCL3_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CCL3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CCL3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CCR5_HUMAN	CCR5	physical	11700073
CCL3_HUMAN	CCL3	physical	8077676
CCL4_HUMAN	CCL4	physical	11278300

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.