CCI1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CCI1_ARATH
• UniProt AC: Q9M643
• Protein Name: Cycloeucalenol cycloisomerase
• Gene Name: CPI1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 280
• Subcellular Localization: Membrane; Multi-pass membrane protein.
• Protein Description: Converts pentacyclic cyclopropyl sterols to tetracyclic sterols..
• Protein Sequence: MSGSSSPSLWLAPNPSKRWGELFFLFYTPFWLTLCLGIVVPYKLYETFTELEYLLLALVSAVPAFVIPMLLVGKADRSLCWKDRYWVKANLWIIVFSYVGNYFWTHYFFKVLGASYTFPSWKMNNVPHTTFFLTHVCFLFYHVASNITLRRLRHSTADLPDSLKWCFEAAWILALSYFIAYLETIAIANFPYYEFVDRSAMYRVGCLFYAIYFIVSFPMFFRMDEKSTDEWDLSRVAVDALGAAMLVTIILDLWRLFLGPIVPLPEGQNCLQSGLPWFSN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
155	Phosphorylation	TLRRLRHSTADLPDS CHHHHHHCCCCCCHH	20.89	24894044

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CCI1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CCI1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CCI1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CLV1_ARATH	CLV1	physical	23776660

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.