| UniProt ID | CC190_HUMAN | |
|---|---|---|
| UniProt AC | Q86UF4 | |
| Protein Name | Coiled-coil domain-containing protein 190 | |
| Gene Name | CCDC190 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 302 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MERHMVRGQLYKHFDLERKNAKQAEARLDQRLQRLKVICLYHVKLLTWEQRQLQKELQRLQQAETMKKKFSSYLGNGFQKRPEDVLVFSPQGRQKHRAPQAKKMRALATRMAQDTCKSKSQVPPSHDAGLKDPMKSKKQPLSQNNRTACFIKEQPQAQEKDSVNPSKDVDPSKGISVPCQNQEVSTNTIEQGPSSSPASDSGMACADETRSKDVALKPDGNTGKQIPPKHMECAGSFEGEFTKPTFLELLSKARNAHYLRHRVPPESERLLSIGEIFGHGESSSSRAGKECENRVPSKFLPL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 11 | Phosphorylation | HMVRGQLYKHFDLER CCCCHHHHHHHCHHH | 24043423 | ||
| 55 | Ubiquitination | WEQRQLQKELQRLQQ HHHHHHHHHHHHHHH | - | ||
| 65 | Phosphorylation | QRLQQAETMKKKFSS HHHHHHHHHHHHHHH | - | ||
| 89 | Phosphorylation | PEDVLVFSPQGRQKH CHHEEEECCCCCCCC | 22199227 | ||
| 142 | Phosphorylation | KSKKQPLSQNNRTAC CCCCCCCCCCCCCEE | 29083192 | ||
| 172 | Phosphorylation | PSKDVDPSKGISVPC CCCCCCCCCCCCCCC | - | ||
| 267 | Phosphorylation | RHRVPPESERLLSIG HCCCCCHHHHHHHHH | 30257219 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CC190_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CC190_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CC190_HUMAN !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...