UniProt ID | CC190_HUMAN | |
---|---|---|
UniProt AC | Q86UF4 | |
Protein Name | Coiled-coil domain-containing protein 190 | |
Gene Name | CCDC190 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 302 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MERHMVRGQLYKHFDLERKNAKQAEARLDQRLQRLKVICLYHVKLLTWEQRQLQKELQRLQQAETMKKKFSSYLGNGFQKRPEDVLVFSPQGRQKHRAPQAKKMRALATRMAQDTCKSKSQVPPSHDAGLKDPMKSKKQPLSQNNRTACFIKEQPQAQEKDSVNPSKDVDPSKGISVPCQNQEVSTNTIEQGPSSSPASDSGMACADETRSKDVALKPDGNTGKQIPPKHMECAGSFEGEFTKPTFLELLSKARNAHYLRHRVPPESERLLSIGEIFGHGESSSSRAGKECENRVPSKFLPL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Phosphorylation | HMVRGQLYKHFDLER CCCCHHHHHHHCHHH | 24043423 | ||
55 | Ubiquitination | WEQRQLQKELQRLQQ HHHHHHHHHHHHHHH | - | ||
65 | Phosphorylation | QRLQQAETMKKKFSS HHHHHHHHHHHHHHH | - | ||
89 | Phosphorylation | PEDVLVFSPQGRQKH CHHEEEECCCCCCCC | 22199227 | ||
142 | Phosphorylation | KSKKQPLSQNNRTAC CCCCCCCCCCCCCEE | 29083192 | ||
172 | Phosphorylation | PSKDVDPSKGISVPC CCCCCCCCCCCCCCC | - | ||
267 | Phosphorylation | RHRVPPESERLLSIG HCCCCCHHHHHHHHH | 30257219 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CC190_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CC190_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CC190_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...