UniProt ID | CC126_HUMAN | |
---|---|---|
UniProt AC | Q96EE4 | |
Protein Name | Coiled-coil domain-containing protein 126 | |
Gene Name | CCDC126 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 140 | |
Subcellular Localization | Secreted . | |
Protein Description | ||
Protein Sequence | MFFTISRKNMSQKLSLLLLVFGLIWGLMLLHYTFQQPRHQSSVKLREQILDLSKRYVKALAEENKNTVDVENGASMAGYADLKRTIAVLLDDILQRLVKLENKVDYIVVNGSAANTTNGTSGNLVPVTTNKRTNVSGSIR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MFFTISRKNMS ----CCCCCCCCCHH | 13.53 | 30622161 | |
6 | Phosphorylation | --MFFTISRKNMSQK --CCCCCCCCCHHHH | 33.86 | 30622161 | |
11 | Phosphorylation | TISRKNMSQKLSLLL CCCCCCHHHHHHHHH | 33.29 | 30622161 | |
54 | Ubiquitination | EQILDLSKRYVKALA HHHHHHHHHHHHHHH | 55.86 | - | |
54 | 2-Hydroxyisobutyrylation | EQILDLSKRYVKALA HHHHHHHHHHHHHHH | 55.86 | - | |
75 | Phosphorylation | VDVENGASMAGYADL EECCCCCCCCHHHHH | 15.57 | 24961811 | |
79 | Phosphorylation | NGASMAGYADLKRTI CCCCCCHHHHHHHHH | 6.34 | 24961811 | |
85 | Phosphorylation | GYADLKRTIAVLLDD HHHHHHHHHHHHHHH | 16.23 | 22210691 | |
85 | O-linked_Glycosylation | GYADLKRTIAVLLDD HHHHHHHHHHHHHHH | 16.23 | OGP | |
110 | N-linked_Glycosylation | KVDYIVVNGSAANTT CCCEEEECCCCCCCC | 28.01 | UniProtKB CARBOHYD | |
133 | Phosphorylation | PVTTNKRTNVSGSIR ECCCCCCCCCCCCCC | 41.40 | 29496963 | |
134 | N-linked_Glycosylation | VTTNKRTNVSGSIR- CCCCCCCCCCCCCC- | 29.95 | UniProtKB CARBOHYD | |
136 | Phosphorylation | TNKRTNVSGSIR--- CCCCCCCCCCCC--- | 28.97 | 28270605 | |
138 | Phosphorylation | KRTNVSGSIR----- CCCCCCCCCC----- | 14.00 | 29496963 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CC126_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CC126_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CC126_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...