UniProt ID | CB4A_ARATH | |
---|---|---|
UniProt AC | Q07473 | |
Protein Name | Chlorophyll a-b binding protein CP29.1, chloroplastic | |
Gene Name | LHCB4.1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 290 | |
Subcellular Localization |
Plastid, chloroplast thylakoid membrane Multi-pass membrane protein. |
|
Protein Description | The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated.. | |
Protein Sequence | MAATSAAAAAASSIMGTRVAPGIHPGSGRFTAVFGFGKKKAAPKKSAKKTVTTDRPLWYPGAISPDWLDGSLVGDYGFDPFGLGKPAEYLQFDIDSLDQNLAKNLAGDVIGTRTEAADAKSTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKVELVDGSSYLGQPLPFSISTLIWIEVLVIGYIEFQRNAELDSEKRLYPGGKFFDPLGLAADPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGPLNNWATHLSDPLHTTIIDTFSSS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MAATSAAAAAA ----CCHHHHHHHHH | 14.90 | 29797451 | |
112 | Phosphorylation | LAGDVIGTRTEAADA HCCCCCCCCCHHCCC | 24.24 | 30291188 | |
114 | Phosphorylation | GDVIGTRTEAADAKS CCCCCCCCHHCCCCC | 29.79 | 30291188 | |
127 | Nitration | KSTPFQPYSEVFGIQ CCCCCCCHHHHHCCC | 13.48 | - | |
212 | Phosphorylation | QRNAELDSEKRLYPG HHCCCCCCCCCCCCC | 58.61 | 25561503 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CB4A_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CB4A_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CB4A_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SUMO3_ARATH | SUMO3 | physical | 20855607 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks."; Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.; Plant Physiol. 150:889-903(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-112 AND THR-114, ANDMASS SPECTROMETRY. |