UniProt ID | CAV2_RAT | |
---|---|---|
UniProt AC | Q2IBC5 | |
Protein Name | Caveolin-2 | |
Gene Name | Cav2 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 162 | |
Subcellular Localization |
Nucleus. Cytoplasm. Golgi apparatus membrane Peripheral membrane protein. Cell membrane Peripheral membrane protein. Membrane, caveola Peripheral membrane protein. Potential hairpin-like structure in the membrane. Membrane protein of caveolae. Tyr |
|
Protein Description | May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression.. | |
Protein Sequence | MGLETEKADVQLFMADDAYSHHSVVDYTDPEKYVDSSQDRDPHQLNSHLKLGFEDLIAEPPTTHSFDKVWICSHALFEISKYVIYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVVIGPLCTSVGRIFSSVSMQLSHD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
19 | Phosphorylation | LFMADDAYSHHSVVD EEECCCCCCCCCCCC | 18.61 | 21940666 | |
20 | Phosphorylation | FMADDAYSHHSVVDY EECCCCCCCCCCCCC | 19.22 | 24945867 | |
23 | Phosphorylation | DDAYSHHSVVDYTDP CCCCCCCCCCCCCCH | 20.57 | 25575281 | |
27 | Phosphorylation | SHHSVVDYTDPEKYV CCCCCCCCCCHHHHC | 11.05 | 24945867 | |
28 | Phosphorylation | HHSVVDYTDPEKYVD CCCCCCCCCHHHHCC | 40.38 | 25575281 | |
36 | Phosphorylation | DPEKYVDSSQDRDPH CHHHHCCCCCCCCHH | 21.61 | - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CAV2_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
IRS1_HUMAN | IRS1 | physical | 25667086 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Caveolin-2 regulation of STAT3 transcriptional activation in responseto insulin."; Kwon H., Jeong K., Hwang E.M., Park J.-Y., Hong S.-G., Choi W.-S.,Pak Y.; Biochim. Biophys. Acta 1793:1325-1333(2009). Cited for: PHOSPHORYLATION AT TYR-19 AND TYR-27, INTERACTION WITH MAPK1 ANDSTAT3, FUNCTION, SUBCELLLULAR LOCATION, AND MUTAGENESIS OF TYR-19 ANDTYR-27. | |
"Identification of pY19-caveolin-2 as a positive regulator of insulin-stimulated actin cytoskeleton-dependent mitogenesis."; Kwon H., Jeong K., Pak Y.; J. Cell. Mol. Med. 13:1549-1564(2009). Cited for: PHOSPHORYLATION AT TYR-19, INTERACTION WITH MAPK1 AND INSR, FUNCTION,SUBCELLLULAR LOCATION, AND MUTAGENESIS OF TYR-19. |