| UniProt ID | CART_HUMAN | |
|---|---|---|
| UniProt AC | Q16568 | |
| Protein Name | Cocaine- and amphetamine-regulated transcript protein | |
| Gene Name | CARTPT | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 116 | |
| Subcellular Localization | Secreted . | |
| Protein Description | Satiety factor closely associated with the actions of leptin and neuropeptide y; this anorectic peptide inhibits both normal and starvation-induced feeding and completely blocks the feeding response induced by neuropeptide Y and regulated by leptin in the hypothalamus. It promotes neuronal development and survival in vitro.. | |
| Protein Sequence | MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 25 | Phosphorylation | LMLPLLGTRAQEDAE HHHHHHCCCHHHCCC | 23.85 | 24114839 | |
| 41 | Phosphorylation | QPRALDIYSAVDDAS CCHHHHHHHHCCCCH | 7.11 | - | |
| 42 | Phosphorylation | PRALDIYSAVDDASH CHHHHHHHHCCCCHH | 23.34 | 23312004 | |
| 48 | Phosphorylation | YSAVDDASHEKELIE HHHCCCCHHHHHHHH | 38.89 | 26657352 | |
| 66 | Phosphorylation | EVLKKLKSKRVPIYE HHHHHHHHCCCCCEE | 35.81 | - | |
| 106 | Phosphorylation | LCDCPRGTSCNSFLL CCCCCCCCCCCHHHH | 31.24 | - | |
| 107 | Phosphorylation | CDCPRGTSCNSFLLK CCCCCCCCCCHHHHH | 17.71 | - | |
| 110 | Phosphorylation | PRGTSCNSFLLKCL- CCCCCCCHHHHHCC- | 22.92 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CART_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CART_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CART_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SDHB_HUMAN | SDHB | physical | 17634068 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
