CAR16_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CAR16_HUMAN
• UniProt AC: Q5EG05
• Protein Name: Caspase recruitment domain-containing protein 16
• Gene Name: CARD16
• Organism: Homo sapiens (Human).
• Sequence Length: 197
• Protein Description: Caspase inhibitor. Acts as a regulator of procaspase-1/CASP1 activation implicated in the regulation of the proteolytic maturation of pro-interleukin-1 beta (IL1B) and its release during inflammation. Inhibits the release of IL1B in response to LPS in monocytes. Also induces NF-kappa-B activation during the pro-inflammatory cytokine response. Also able to inhibit CASP1-mediated neuronal cell death, TNF-alpha, hypoxia-, UV-, and staurosporine-mediated cell death but not ER stress-mediated cell death. Acts by preventing activation of caspases CASP1 and CASP4, possibly by preventing the interaction between CASP1 and RIPK2..
• Protein Sequence: MADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAETLGLSAALQAVQDNPAMPTCSSPEGRIKLCFLEDAQRIWKQKLQRCHVQNTIIKWSERYTSGSFEMQWLFLRTNFIERFWRNILLLPLHKGSLYPRIPGLGKELQTGTHKLS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
21	Phosphorylation	IHSMGEGTINGLLDE EECCCCCHHHHHHHH	13.63	27067055
49	Phosphorylation	KVKRENATVMDKTRA HHHHHCCCHHHHHHH	28.13	28348404
53	Ubiquitination	ENATVMDKTRALIDS HCCCHHHHHHHHHHH	23.09	29967540

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CAR16_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CAR16_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CAR16_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RIPK2_HUMAN	RIPK2	physical	11432859
CAR16_HUMAN	CARD16	physical	11432859
CASP1_HUMAN	CASP1	physical	11432859

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.