CAL_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CAL_ARATH
• UniProt AC: Q39081
• Protein Name: Transcription factor CAULIFLOWER
• Gene Name: CAL
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 255
• Subcellular Localization: Nucleus.
• Protein Description: Probable transcription factor that promotes early floral meristem identity in synergy with APETALA1, FRUITFULL and LEAFY. Is required subsequently for the transition of an inflorescence meristem into a floral meristem. Seems to be partially redundant to the function of APETALA1. Positively regulates the APETALA1 and LEAFY expression..
• Protein Sequence: MGRGRVELKRIENKINRQVTFSKRRTGLLKKAQEISVLCDAEVSLIVFSHKGKLFEYSSESCMEKVLERYERYSYAERQLIAPDSHVNAQTNWSMEYSRLKAKIELLERNQRHYLGEELEPMSLKDLQNLEQQLETALKHIRSRKNQLMNESLNHLQRKEKEIQEENSMLTKQIKERENILRTKQTQCEQLNRSVDDVPQPQPFQHPHLYMIAHQTSPFLNMGGLYQEEDQTAMRRNNLDLTLEPIYNYLGCYAA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of CAL_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CAL_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CAL_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CAL_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SEP3_ARATH	SEP3	physical	11439126
SOC1_ARATH	AGL20	physical	11439126
SVP_ARATH	SVP	physical	11439126
AGL24_ARATH	AGL24	physical	11439126

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.