dbPTM

CALM7_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CALM7_ARATH
UniProt AC	P59220
Protein Name	Calmodulin-7
Gene Name	CAM7
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	149
Subcellular Localization
Protein Description	Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+). Among the enzymes to be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases. Activates MPK8 in vitro..
Protein Sequence	MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MADQLTDDQISEF --CCCCCCHHHHHHH	31.71	25368622
11	Phosphorylation	QLTDDQISEFKEAFS CCCHHHHHHHHHHHH	31.20	30589143
18	Phosphorylation	SEFKEAFSLFDKDGD HHHHHHHHHCCCCCC	34.86	30589143
80	Phosphorylation	MARKMKDTDSEEELK HHHHHCCCCCHHHHH	35.59	30291188
82	Phosphorylation	RKMKDTDSEEELKEA HHHCCCCCHHHHHHH	49.34	30291188
102	Phosphorylation	KDQNGFISAAELRHV CCCCCCCCHHHHHHH	21.11	30291188
118	Phosphorylation	TNLGEKLTDEEVDEM HHHHCCCCHHHHHHH	53.05	30291188

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CALM7_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CALM7_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CALM7_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ERDL4_ARATH	AT1G19450	physical	22737156
ACA8_ARATH	ACA8	physical	23086147
HY5_ARATH	HY5	physical	24610722

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CALM7_ARATH

Related Literatures of Post-Translational Modification