CAH1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CAH1_MOUSE
• UniProt AC: P13634
• Protein Name: Carbonic anhydrase 1
• Gene Name: Ca1
• Organism: Mus musculus (Mouse).
• Sequence Length: 261
• Subcellular Localization: Cytoplasm.
• Protein Description: Reversible hydration of carbon dioxide..
• Protein Sequence: MASADWGYGSENGPDQWSKLYPIANGNNQSPIDIKTSEANHDSSLKPLSISYNPATAKEIVNVGHSFHVIFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGTRYSGELHLVHWNSAKYSSASEAISKADGLAILGVLMKVGPANPSLQKVLDALNSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKDSISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MASADWGYG ------CCCCCCCCC	17.27	-
46	Acetylation	ANHDSSLKPLSISYN CCCCCCCCCCEEECC	45.95	22733758
46	Ubiquitination	ANHDSSLKPLSISYN CCCCCCCCCCEEECC	45.95	22790023
46	Ubiquitination	ANHDSSLKPLSISYN CCCCCCCCCCEEECC	45.95	22790023
49	Phosphorylation	DSSLKPLSISYNPAT CCCCCCCEEECCHHC	20.30	29472430
51	Phosphorylation	SLKPLSISYNPATAK CCCCCEEECCHHCHH	18.58	29472430
52	Phosphorylation	LKPLSISYNPATAKE CCCCEEECCHHCHHH	24.40	29472430
56	Phosphorylation	SISYNPATAKEIVNV EEECCHHCHHHHEEC	39.25	29472430
88	Phosphorylation	KGGPLADSYRLTQFH CCCCCCCEEEEEEEE	13.42	29472430
160	Acetylation	PANPSLQKVLDALNS CCCHHHHHHHHHHHC	50.48	22733758
160	Ubiquitination	PANPSLQKVLDALNS CCCHHHHHHHHHHHC	50.48	22790023
160	Ubiquitination	PANPSLQKVLDALNS CCCHHHHHHHHHHHC	50.48	22790023

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CAH1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CAH1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CAH1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LNX1_MOUSE	Lnx1	physical	12468544

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.