CADH5_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CADH5_ARATH
• UniProt AC: O49482
• Protein Name: Cinnamyl alcohol dehydrogenase 5
• Gene Name: CAD5
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 357
• Protein Description: Involved in lignin biosynthesis in the floral stem. Catalyzes the final step specific for the production of lignin monomers. Catalyzes the NADPH-dependent reduction of coniferaldehyde, 5-hydroxyconiferaldehyde, sinapaldehyde, 4-coumaraldehyde and caffeyl aldehyde to their respective alcohols..
• Protein Sequence: MGIMEAERKTTGWAARDPSGILSPYTYTLRETGPEDVNIRIICCGICHTDLHQTKNDLGMSNYPMVPGHEVVGEVVEVGSDVSKFTVGDIVGVGCLVGCCGGCSPCERDLEQYCPKKIWSYNDVYINGQPTQGGFAKATVVHQKFVVKIPEGMAVEQAAPLLCAGVTVYSPLSHFGLKQPGLRGGILGLGGVGHMGVKIAKAMGHHVTVISSSNKKREEALQDLGADDYVIGSDQAKMSELADSLDYVIDTVPVHHALEPYLSLLKLDGKLILMGVINNPLQFLTPLLMLGRKVITGSFIGSMKETEEMLEFCKEKGLSSIIEVVKMDYVNTAFERLEKNDVRYRFVVDVEGSNLDA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Sulfoxidation	----MGIMEAERKTT ----CCCCCCCCCCC	3.10	25693801

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CADH5_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CADH5_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CADH5_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ABI5_ARATH	ABI5	physical	24823379
CADH5_ARATH	CAD5	physical	24823379

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.