dbPTM

CA050_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CA050_HUMAN
UniProt AC	Q9BV19
Protein Name	Uncharacterized protein C1orf50
Gene Name	C1orf50
Organism	Homo sapiens (Human).
Sequence Length	199
Subcellular Localization
Protein Description
Protein Sequence	MEDAAAPGRTEGVLERQGAPPAAGQGGALVELTPTPGGLALVSPYHTHRAGDPLDLVALAEQVQKADEFIRANATNKLTVIAEQIQHLQEQARKVLEDAHRDANLHHVACNIVKKPGNIYYLYKRESGQQYFSIISPKEWGTSCPHDFLGAYKLQHDLSWTPYEDIEKQDAKISMMDTLLSQSVALPPCTEPNFQGLTH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MEDAAAPG -------CCCCCCCC	10.70	-
33	Phosphorylation	GGALVELTPTPGGLA CCEEEEEECCCCCEE	16.17	22210691
35	Phosphorylation	ALVELTPTPGGLALV EEEEEECCCCCEEEE	29.36	28122231
43	Phosphorylation	PGGLALVSPYHTHRA CCCEEEECCCCCCCC	22.16	25159151
45	Phosphorylation	GLALVSPYHTHRAGD CEEEECCCCCCCCCC	16.31	22210691
47	Phosphorylation	ALVSPYHTHRAGDPL EEECCCCCCCCCCCH	13.76	22210691
65	Ubiquitination	ALAEQVQKADEFIRA HHHHHHHHHHHHHHC	59.97	29967540
94	Ubiquitination	HLQEQARKVLEDAHR HHHHHHHHHHHHHHH	54.94	24816145
127	Phosphorylation	YYLYKRESGQQYFSI EEEEECCCCCEEEEE	46.03	25159151
131	Phosphorylation	KRESGQQYFSIISPK ECCCCCEEEEEECHH	7.45	21406692
133	Phosphorylation	ESGQQYFSIISPKEW CCCCEEEEEECHHHC	17.68	21406692
136	Phosphorylation	QQYFSIISPKEWGTS CEEEEEECHHHCCCC	28.40	24719451
163	Phosphorylation	HDLSWTPYEDIEKQD CCCCCCCHHHHHHHH	20.89	27642862

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CA050_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CA050_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CA050_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
CA050_HUMAN	C1orf50	physical	25416956
EPMIP_HUMAN	EPM2AIP1	physical	21516116

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CA050_HUMAN

Related Literatures of Post-Translational Modification