| UniProt ID | C42S2_HUMAN | |
|---|---|---|
| UniProt AC | Q9NRR3 | |
| Protein Name | CDC42 small effector protein 2 | |
| Gene Name | CDC42SE2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 84 | |
| Subcellular Localization |
Cytoplasm, cytoskeleton. Cell membrane Lipid-anchor. Cell projection, phagocytic cup. Recruited to the activated TCR prior actin polymerization. Localizes at the phagocytic cup of macrophages. |
|
| Protein Description | Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages.. | |
| Protein Sequence | MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 10 | S-palmitoylation | EFWLCFNCCIAEQPQ CEEEEHHHHHHCCCC | 0.62 | 15840583 | |
| 11 | S-palmitoylation | FWLCFNCCIAEQPQP EEEEHHHHHHCCCCC | 3.29 | 15840583 | |
| 27 | Phosphorylation | RRRRIDRSMIGEPTN HHHCCCHHHCCCCCC | 15.82 | 27422710 | |
| 33 | Phosphorylation | RSMIGEPTNFVHTAH HHHCCCCCCEEEEEE | 36.67 | 27080861 | |
| 38 | Phosphorylation | EPTNFVHTAHVGSGD CCCCEEEEEECCCCC | 17.10 | 26074081 | |
| 43 | Phosphorylation | VHTAHVGSGDLFSGM EEEEECCCCCCCCCC | 28.22 | 26657352 | |
| 48 | Phosphorylation | VGSGDLFSGMNSVSS CCCCCCCCCCCHHHH | 44.42 | 28270605 | |
| 52 | Phosphorylation | DLFSGMNSVSSIQNQ CCCCCCCHHHHHHHH | 17.93 | 27080861 | |
| 54 | Phosphorylation | FSGMNSVSSIQNQMQ CCCCCHHHHHHHHHH | 22.88 | 27080861 | |
| 55 | Phosphorylation | SGMNSVSSIQNQMQS CCCCHHHHHHHHHHH | 26.49 | 28270605 | |
| 62 | Phosphorylation | SIQNQMQSKGGYGGG HHHHHHHHCCCCCCC | 28.11 | 27080861 | |
| 66 | Phosphorylation | QMQSKGGYGGGMPAN HHHHCCCCCCCCCCC | 22.67 | 29978859 | |
| 82 | Ubiquitination | QMQLVDTKAG----- EEEEEECCCC----- | 46.80 | 21963094 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of C42S2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of C42S2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of C42S2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CDC42_HUMAN | CDC42 | physical | 28514442 | |
| T22D3_HUMAN | TSC22D3 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Palmitoylation | |
| Reference | PubMed |
| "The role of SPECs, small Cdc42-binding proteins, in F-actinaccumulation at the immunological synapse."; Ching K.H., Kisailus A.E., Burbelo P.D.; J. Biol. Chem. 280:23660-23667(2005). Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, AND PALMITOYLATIONAT CYS-10 AND CYS-11. | |
