UniProt ID | C1QT3_HUMAN | |
---|---|---|
UniProt AC | Q9BXJ4 | |
Protein Name | Complement C1q tumor necrosis factor-related protein 3 | |
Gene Name | C1QTNF3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 246 | |
Subcellular Localization | Secreted . | |
Protein Description | ||
Protein Sequence | MLWRQLIYWQLLALFFLPFCLCQDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
70 (in isoform 3) | N-linked_Glycosylation | - | 45.76 | - | |
89 | Acetylation | AKGEKGDKGDLGPRG CCCCCCCCCCCCCCC | 64.09 | 7669935 | |
104 | Acetylation | ERGQHGPKGEKGYPG CCCCCCCCCCCCCCC | 81.78 | 7669943 | |
179 | Phosphorylation | HEDVEEVYVYLMHNG CCCHHEEEEEEEECC | 6.15 | - | |
205 | Phosphorylation | KGKSDTSSNHAVLKL CCCCCCCCCCEEEHH | 34.43 | 28787133 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of C1QT3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
70 | N | Glycosylation |
| 19139490 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of C1QT3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GT252_HUMAN | COLGALT2 | physical | 26186194 | |
GT252_HUMAN | COLGALT2 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...