| UniProt ID | C1GLT_HUMAN | |
|---|---|---|
| UniProt AC | Q9NS00 | |
| Protein Name | Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 | |
| Gene Name | C1GALT1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 363 | |
| Subcellular Localization |
Membrane Single-pass type II membrane protein. |
|
| Protein Description | Glycosyltransferase that generates the core 1 O-glycan Gal-beta1-3GalNAc-alpha1-Ser/Thr (T antigen), which is a precursor for many extended O-glycans in glycoproteins. Plays a central role in many processes, such as angiogenesis, thrombopoiesis and kidney homeostasis development.. | |
| Protein Sequence | MASKSWLNFLTFLCGSAIGFLLCSQLFSILLGEKVDTQPNVLHNDPHARHSDDNGQNHLEGQMNFNADSSQHKDENTDIAENLYQKVRILCWVMTGPQNLEKKAKHVKATWAQRCNKVLFMSSEENKDFPAVGLKTKEGRDQLYWKTIKAFQYVHEHYLEDADWFLKADDDTYVILDNLRWLLSKYDPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDAFKTDKCTHSSSIEDLALGRCMEIMNVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDTKVKLGNP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 70 | O-linked_Glycosylation | MNFNADSSQHKDENT CCCCCCCHHCCCCCC | 36.53 | OGP | |
| 108 | Ubiquitination | EKKAKHVKATWAQRC HHHHHHHHHHHHHHH | 39.56 | - | |
| 127 | Ubiquitination | FMSSEENKDFPAVGL EECCCCCCCCCCCCC | 65.12 | - | |
| 146 | Ubiquitination | GRDQLYWKTIKAFQY CCHHHHHHHHHHHHH | 27.15 | - | |
| 185 | Ubiquitination | NLRWLLSKYDPEEPI CHHHHHHCCCCCCCC | 54.35 | 2190698 | |
| 185 (in isoform 2) | Ubiquitination | - | 54.35 | 21906983 | |
| 185 (in isoform 1) | Ubiquitination | - | 54.35 | 21906983 | |
| 186 | Phosphorylation | LRWLLSKYDPEEPIY HHHHHHCCCCCCCCC | 33.10 | - | |
| 193 | Phosphorylation | YDPEEPIYFGRRFKP CCCCCCCCCCCCCCC | 15.65 | - | |
| 206 | Phosphorylation | KPYVKQGYMSGGAGY CCCEECCCCCCCCCC | 5.89 | 22817900 | |
| 208 | Phosphorylation | YVKQGYMSGGAGYVL CEECCCCCCCCCCCC | 26.12 | - | |
| 213 | Phosphorylation | YMSGGAGYVLSKEAL CCCCCCCCCCCHHHH | 9.55 | 22817900 | |
| 217 | Ubiquitination | GAGYVLSKEALKRFV CCCCCCCHHHHHHHH | 42.73 | - | |
| 228 | Ubiquitination | KRFVDAFKTDKCTHS HHHHHHHCCCCCCCC | 58.49 | - | |
| 235 | Phosphorylation | KTDKCTHSSSIEDLA CCCCCCCCCCHHHHH | 13.97 | 28857561 | |
| 236 | Phosphorylation | TDKCTHSSSIEDLAL CCCCCCCCCHHHHHH | 27.94 | 28857561 | |
| 237 | Phosphorylation | DKCTHSSSIEDLALG CCCCCCCCHHHHHHC | 32.77 | - | |
| 263 | Ubiquitination | DSRDTIGKETFHPFV CCCCCCCCCCCCCCC | 50.13 | - | |
| 345 | Ubiquitination | TLPERILKEISQANK CCCHHHHHHHHHHCC | 51.10 | - | |
| 345 | Acetylation | TLPERILKEISQANK CCCHHHHHHHHHHCC | 51.10 | 7959439 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of C1GLT_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of C1GLT_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of C1GLT_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| C1GLC_HUMAN | C1GALT1C1 | physical | 18695044 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
