UniProt ID | BY55_HUMAN | |
---|---|---|
UniProt AC | O95971 | |
Protein Name | CD160 antigen | |
Gene Name | CD160 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 181 | |
Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor. |
|
Protein Description | Receptor showing broad specificity for both classical and non-classical MHC class I molecules.. | |
Protein Sequence | MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQAL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
28 | N-linked_Glycosylation | IQSGGCINITSSASQ HCCCCEEEECCCCCC | 35.25 | UniProtKB CARBOHYD | |
65 | Phosphorylation | VFLCKDRSGDCSPET EEEECCCCCCCCCCC | 49.47 | - | |
69 | Phosphorylation | KDRSGDCSPETSLKQ CCCCCCCCCCCCHHH | 30.43 | - | |
72 | Phosphorylation | SGDCSPETSLKQLRL CCCCCCCCCHHHHHC | 42.62 | - | |
73 | Phosphorylation | GDCSPETSLKQLRLK CCCCCCCCHHHHHCC | 31.72 | - | |
137 | N-linked_Glycosylation | ILFTETGNYTVTGLK EEEECCCCEEEECCE | 36.40 | UniProtKB CARBOHYD | |
159 | GPI-anchor | SHNEGTLSSGFLQEK CCCCCCCCCCCHHHH | 28.40 | - | |
182 | Phosphorylation | LVALQAL-------- HHHHHHC-------- | 19664995 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BY55_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BY55_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BY55_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TNR14_HUMAN | TNFRSF14 | physical | 21982860 | |
ATRAP_HUMAN | AGTRAP | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...