BTG2_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BTG2_RAT
• UniProt AC: P27049
• Protein Name: Protein BTG2
• Gene Name: Btg2
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 158
• Protein Description: Anti-proliferative protein; the function is mediated by association with deadenylase subunits of the CCR4-NOT complex. Activates mRNA deadenylation in a CNOT6 and CNOT7-dependent manner. In vitro can inhibit deadenylase activity of CNOT7 and CNOT8. Involved in cell cycle regulation. Could be involved in the growth arrest and differentiation of the neuronal precursors. Modulates transcription regulation mediated by ESR1. Involved in mitochondrial depolarization and neurite outgrowth (By similarity)..
• Protein Sequence: MSHGKRTDMLPEIAAAVGFLTSLLRTRGCVSEQRLKVFSRALQDALTDHYKHHWFPEKPSKGSGYRCIRINHKMDPIISKVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPVATSYGLLTCKNQMMLGRSSPSKNYVMTVSS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
147	Phosphorylation	QMMLGRSSPSKNYVM CEECCCCCCCCCEEE	31.65	-
149	Phosphorylation	MLGRSSPSKNYVMTV ECCCCCCCCCEEEEE	35.17	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
147	S	Phosphorylation	Kinase	MAPK1	P63086	Uniprot
147	S	Phosphorylation	Kinase	MAPK3	P21708	Uniprot
149	S	Phosphorylation	Kinase	MAPK14	P70618	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
147	S	Phosphorylation	Phosphorylated at Ser-147 by MAPK1/ERK2 and MAPK3/ERK1, and at Ser-149 by MAPK14, leading to PIN1-binding and mitochondrial depolarization.	-
149	S	Phosphorylation	Phosphorylated at Ser-147 by MAPK1/ERK2 and MAPK3/ERK1, and at Ser-149 by MAPK14, leading to PIN1-binding and mitochondrial depolarization.	-

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BTG2_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HDAC1_HUMAN	HDAC1	physical	27333946

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.