dbPTM

BRRF1_EBVG - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	BRRF1_EBVG
UniProt AC	P0C722
Protein Name	Transcriptional activator BRRF1
Gene Name	BRRF1
Organism	Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4).
Sequence Length	310
Subcellular Localization
Protein Description	Enhances the ability of BRLF1 to induce lytic infection by cooperating with it to transcriptionally activate the BZLF1 promoter..
Protein Sequence	MASSNRGNARPLKSFLHELYLKHYPEVGDVVHLLNTIGVDCDLPPSHPLLTAQRGLFLARVLQAVQQHKLLEDTIVPKILKKLAYFLELLSYYSPKDEQRDIAEVLDHLKTNRDLGLDDRLWALIRKLRQDRHHASVNVLMPGSDYTAVSLQYYDGISIGMRKVIADVCRSGYASMPSMTATHNLSHQLLMASGPSEEPCAWRGFFNQVLLWTVALCKFRRCIYYNYIQGSIATISQLLHLEIKALCSWIISQDGMRLFQHSRPLLTLWESVAANQEVTDAITLPDCAEYIDLLKHTKHVLENCSAMQYK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of BRRF1_EBVG !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of BRRF1_EBVG !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of BRRF1_EBVG !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of BRRF1_EBVG !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
TRAF2_HUMAN	TRAF2	physical	21325409
NFKB2_HUMAN	NFKB2	physical	21325409

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of BRRF1_EBVG

Related Literatures of Post-Translational Modification