BQT2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BQT2_SCHPO
• UniProt AC: Q9US52
• Protein Name: Telomere bouquet protein 2
• Gene Name: bqt2
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 118
• Subcellular Localization: Cytoplasm. Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body. Chromosome, telomere. Colocalizes with the telomere cluster during the 'horsetail' stage and then disappears before the first meiotic division.
• Protein Description: Involved in chromosome segregation. During meiotic prophase, connects telomeres to the spindle pole body by forming a bridge between the telomere protein rap1 and the spindle pole body protein sad1..
• Protein Sequence: MFQGKCAFFDETVPSALIALWQLHNGEAKFLAEGYENFDYAFSMHLRKHVRLPNYKSVQCRSPWWIAEQVAVSRSKSYVSEPVIHLNVMEPLYVDHRIRSVYLQPLPSTLSFLNGELP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of BQT2_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BQT2_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BQT2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BQT2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BQT1_SCHPO	bqt1	physical	16615890
RAP1_SCHPO	rap1	physical	16615890
BQT1_SCHPO	bqt1	physical	20364342
RAP1_SCHPO	rap1	physical	22959349
SYH_SCHPO	hrs1	genetic	24954111
DYHC_SCHPO	dhc1	genetic	24954111

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.