UniProt ID | BQT2_SCHPO | |
---|---|---|
UniProt AC | Q9US52 | |
Protein Name | Telomere bouquet protein 2 | |
Gene Name | bqt2 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 118 | |
Subcellular Localization | Cytoplasm. Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body. Chromosome, telomere. Colocalizes with the telomere cluster during the 'horsetail' stage and then disappears before the first meiotic division. | |
Protein Description | Involved in chromosome segregation. During meiotic prophase, connects telomeres to the spindle pole body by forming a bridge between the telomere protein rap1 and the spindle pole body protein sad1.. | |
Protein Sequence | MFQGKCAFFDETVPSALIALWQLHNGEAKFLAEGYENFDYAFSMHLRKHVRLPNYKSVQCRSPWWIAEQVAVSRSKSYVSEPVIHLNVMEPLYVDHRIRSVYLQPLPSTLSFLNGELP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of BQT2_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BQT2_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BQT2_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BQT2_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BQT1_SCHPO | bqt1 | physical | 16615890 | |
RAP1_SCHPO | rap1 | physical | 16615890 | |
BQT1_SCHPO | bqt1 | physical | 20364342 | |
RAP1_SCHPO | rap1 | physical | 22959349 | |
SYH_SCHPO | hrs1 | genetic | 24954111 | |
DYHC_SCHPO | dhc1 | genetic | 24954111 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...