BORG3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BORG3_HUMAN
• UniProt AC: Q6NZY7
• Protein Name: Cdc42 effector protein 5
• Gene Name: CDC42EP5
• Organism: Homo sapiens (Human).
• Sequence Length: 148
• Subcellular Localization: Endomembrane system; Peripheral membrane protein. Cytoplasm, cytoskeleton.
• Protein Description: Probably involved in the organization of the actin cytoskeleton. May act downstream of CDC42 to induce actin filament assembly leading to cell shape changes. Induces pseudopodia formation in fibroblasts. Inhibits MAPK8 independently of CDC42 binding. Controls septin organization and this effect is negatively regulated by CDC42 (By similarity)..
• Protein Sequence: MPVLKQLGPAQPKKRPDRGALSISAPLGDFRHTLHVGRGGDAFGDTSFLSRHGGGPPPEPRAPPAGAPRSPPPPAVPQSAAPSPADPLLSFHLDLGPSMLDAVLGVMDAARPEAAAAKPDAEPRPGTQPPQARCRPNADLELNDVIGL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
22	Phosphorylation	RPDRGALSISAPLGD CCCCCCEEEEEECCC	17.60	24719451
24	Phosphorylation	DRGALSISAPLGDFR CCCCEEEEEECCCCC	22.06	28348404
38	Methylation	RHTLHVGRGGDAFGD CCEEECCCCCCCCCC	44.85	-
46	Phosphorylation	GGDAFGDTSFLSRHG CCCCCCCCHHHHHCC	23.04	23312004
47	Phosphorylation	GDAFGDTSFLSRHGG CCCCCCCHHHHHCCC	29.00	23312004
50	Phosphorylation	FGDTSFLSRHGGGPP CCCCHHHHHCCCCCC	21.88	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BORG3_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BORG3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BORG3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SEPT7_MOUSE	Sept7	physical	11584266
SEPT2_MOUSE	Sept2	physical	11584266
SEPT6_MOUSE	Sept6	physical	11584266
CDC42_HUMAN	CDC42	physical	10490598

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.