UniProt ID | BOREA_DROME | |
---|---|---|
UniProt AC | Q9VLD6 | |
Protein Name | Borealin | |
Gene Name | borr | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 315 | |
Subcellular Localization | Nucleus . Chromosome, centromere . Cytoplasm, cytoskeleton, spindle . Localizes on chromosome arms and inner centromeres from prophase through metaphase and then transferring to the spindle midzone and midbody from anaphase through cytokinesis. Coloc | |
Protein Description | Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of embryonic mitosis. The CPC complex has essential functions at the centromere for ensuring sister chromatid cohesion, recruitment of the CPC to kinetochores, and chromosome alignment and segregation. There is no function in meiotic histone phosphorylation or spindle formation.. | |
Protein Sequence | MPRTKIPKNSKRNREVANREEKVRLYELKMDSRLISIDSLETKFLSAVDHQVKTLLGQVQKELANLKMPEVLRLFEELDRFSDFKASDQTQLLASMSMSGSAIEGHAPSATGSRNDEEDSSIGASGGSILAAHTGSLLRSTKAMRTPGPLHSARARRARRSRSACGDLNILHSAKPPSISSSSSSSRNSRSKLRTPMASRAKAFSADRTPLKQKQMRSGSPTTPPMAFLRYPKPGEVALSKYGSPMVAQVMPDKFANVNIPIRNGVLSLRPKKLDADEVESNLLENLDEDTLNQIKTLHENLQMIVNKASQAVFK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
36 | Phosphorylation | KMDSRLISIDSLETK CCCCCEEEHHHHCHH | 25.57 | 25749252 | |
97 | Phosphorylation | TQLLASMSMSGSAIE HHHHHHHHCCCCCEE | 13.80 | 21082442 | |
99 | Phosphorylation | LLASMSMSGSAIEGH HHHHHHCCCCCEECC | 23.45 | 21082442 | |
101 | Phosphorylation | ASMSMSGSAIEGHAP HHHHCCCCCEECCCC | 20.83 | 21082442 | |
146 | Phosphorylation | RSTKAMRTPGPLHSA HHCCCCCCCCCHHHH | 21.36 | 22817900 | |
152 | Phosphorylation | RTPGPLHSARARRAR CCCCCHHHHHHHHHH | 27.42 | 22817900 | |
161 | Phosphorylation | RARRARRSRSACGDL HHHHHHHHHHCCCCC | 25.65 | 21082442 | |
163 | Phosphorylation | RRARRSRSACGDLNI HHHHHHHHCCCCCCC | 29.20 | 19429919 | |
173 | Phosphorylation | GDLNILHSAKPPSIS CCCCCCCCCCCCCCC | 34.24 | 22817900 | |
180 | Phosphorylation | SAKPPSISSSSSSSR CCCCCCCCCCCCCCC | 28.62 | 21082442 | |
195 | Phosphorylation | NSRSKLRTPMASRAK CCCHHCCCCCHHHHH | 28.05 | 22817900 | |
205 | Phosphorylation | ASRAKAFSADRTPLK HHHHHHHCCCCCCCC | 33.83 | 19429919 | |
209 | Phosphorylation | KAFSADRTPLKQKQM HHHCCCCCCCCHHHH | 33.26 | 25749252 | |
218 | Phosphorylation | LKQKQMRSGSPTTPP CCHHHHHCCCCCCCC | 37.98 | 19429919 | |
220 | Phosphorylation | QKQMRSGSPTTPPMA HHHHHCCCCCCCCCE | 21.96 | 19429919 | |
222 | Phosphorylation | QMRSGSPTTPPMAFL HHHCCCCCCCCCEEC | 54.34 | 19429919 | |
223 | Phosphorylation | MRSGSPTTPPMAFLR HHCCCCCCCCCEECC | 28.87 | 19429919 | |
242 | Phosphorylation | GEVALSKYGSPMVAQ CCEEHHHCCCCCEEE | 21.33 | 22817900 | |
244 | Phosphorylation | VALSKYGSPMVAQVM EEHHHCCCCCEEECC | 13.51 | 22817900 | |
268 | Phosphorylation | PIRNGVLSLRPKKLD EEECCCCCCCCCCCC | 21.67 | 21082442 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BOREA_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BOREA_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BOREA_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BOREA_DROME | borr | physical | 18268101 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-146; SER-152; SER-163;SER-205; THR-209; SER-218; SER-220 AND SER-244, AND MASS SPECTROMETRY. |