UniProt ID | BORA_DROME | |
---|---|---|
UniProt AC | Q9VVR2 | |
Protein Name | Protein aurora borealis | |
Gene Name | bora | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 539 | |
Subcellular Localization | Cytoplasm . Nucleus . Shuttles between the cytoplasm and the nucleus. In interphase cells, it is nuclear. Upon entry into mitosis, it is excluded from the nucleus and translocates into the cytoplasm in a Cdk1-dependent manner. | |
Protein Description | Required for the activation of Aurora-A (aur) at the onset of mitosis.. | |
Protein Sequence | MYNDEVRTPQALKNRYITNVNGLKCRARRNSHSNSSNSSAASATPTNGGKENGKYSPQMSGNVCTPPPKRLHKVRNPFEGAMADRLHLPLIASPSLFRSRTPQLSSTQFEWNIDEVSQLKPADVEPHETQFHDSPDPEQESKAQLAISAFFKESLIVPSPVDCPLRKQRIILNCSEDNTPISNKSRRMRDCEVQTELTLPPILPKALEDALRPYFQPHLAGRLSGRSKSSGGPDIFNSSMRRKLFDLHNVIVLGEQDTAEPSRSMVGSSPQGKQTMFAGRLSDSASGESSFGCLSPIRNLCGLPPGTPDNGTCSGKRKLLMHELELPSPIAPSEHLSRRLVHSKVEISVTEQHDTLSERTALKFTPDRSSSPMGGGLEHSDCSINQRVRRLRVNSTRQVVIETGDQPLFEETEGEEEEAESEDDEEADAMQLSTVSFNCSSSNSDTPRGHKRHRSAQRKNLSQSFSANLEEEADQTQGGAGSIQPAEPPSVAMPQQGARIPLYRADSGFNETSSTTFAFSQDLPLDVSMACCSTPSTRS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
31 | Phosphorylation | KCRARRNSHSNSSNS EEEHHCCCCCCCCCC | 26.87 | 21082442 | |
33 | Phosphorylation | RARRNSHSNSSNSSA EHHCCCCCCCCCCCC | 37.92 | 21082442 | |
179 | Phosphorylation | LNCSEDNTPISNKSR EECCCCCCCCCCCCH | 34.03 | 25749252 | |
264 | Phosphorylation | DTAEPSRSMVGSSPQ CCCCCCHHHCCCCCC | 23.35 | 25749252 | |
328 | Phosphorylation | MHELELPSPIAPSEH EEEECCCCCCCCCHH | 41.38 | 21082442 | |
383 | Phosphorylation | GLEHSDCSINQRVRR CCCCCCCCHHHHHHH | 29.57 | 18327897 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BORA_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BORA_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BORA_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DYL1_DROME | ctp | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...