UniProt ID | BOP_HUMAN | |
---|---|---|
UniProt AC | Q7L3V2 | |
Protein Name | Protein Bop {ECO:0000303|PubMed:23055042} | |
Gene Name | RTL10 {ECO:0000312|HGNC:HGNC:26112} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 364 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | Could induce apoptosis in a BH3 domain-dependent manner. The direct interaction network of Bcl-2 family members may play a key role in modulation RTL10/BOP intrinsic apoptotic signaling activity.. | |
Protein Sequence | MPRGRCRQQGPRIPIWAAANYANAHPWQQMDKASPGVAYTPLVDPWIERPCCGDTVCVRTTMEQKSTASGTCGGKPAERGPLAGHMPSSRPHRVDFCWVPGSDPGTFDGSPWLLDRFLAQLGDYMSFHFEHYQDNISRVCEILRRLTGRAQAWAAPYLDGDLPLPDDYELFCQDLKEVVQDPNSFAEYHAVVTCPLPLASSQLPVAPQLPVVRQYLARFLEGLALDMGTAPRSLPAAMATPAVSGSNSVSRSALFEQQLTKESTPGPKEPPVLPSSTCSSKPGPVEPASSQPEEAAPTPVPRLSESANPPAQRPDPAHPGGPKPQKTEEEVLETEGDQEVSLGTPQEVVEAPETPGEPPLSPGF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
21 | Phosphorylation | PIWAAANYANAHPWQ CEEHHHCCCCCCHHH | 27642862 | ||
34 | Phosphorylation | WQQMDKASPGVAYTP HHHHCCCCCCCEECC | 25159151 | ||
39 | Phosphorylation | KASPGVAYTPLVDPW CCCCCCEECCCCCCC | 27642862 | ||
65 | Ubiquitination | VRTTMEQKSTASGTC EECCCCCCCCCCCCC | - | ||
71 | Phosphorylation | QKSTASGTCGGKPAE CCCCCCCCCCCCCCC | 22210691 | ||
89 | Phosphorylation | LAGHMPSSRPHRVDF CCCCCCCCCCCCCEE | 22210691 | ||
233 | Phosphorylation | DMGTAPRSLPAAMAT CCCCCCCCCCHHHCC | 28555341 | ||
252 | Phosphorylation | GSNSVSRSALFEQQL CCCCCCHHHHHHHHH | 29449344 | ||
260 | Phosphorylation | ALFEQQLTKESTPGP HHHHHHHCCCCCCCC | 29449344 | ||
276 | Phosphorylation | EPPVLPSSTCSSKPG CCCCCCCCCCCCCCC | 26657352 | ||
277 | Phosphorylation | PPVLPSSTCSSKPGP CCCCCCCCCCCCCCC | 26657352 | ||
290 | Phosphorylation | GPVEPASSQPEEAAP CCCCCCCCCCCCCCC | 25627689 | ||
306 | Phosphorylation | PVPRLSESANPPAQR CCCCCCCCCCCCCCC | 28555341 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BOP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BOP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BOP_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BRCA1_HUMAN | BRCA1 | physical | 25184681 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...