UniProt ID | BLID_HUMAN | |
---|---|---|
UniProt AC | Q8IZY5 | |
Protein Name | BH3-like motif-containing cell death inducer | |
Gene Name | BLID | |
Organism | Homo sapiens (Human). | |
Sequence Length | 108 | |
Subcellular Localization | Cytoplasm . Mitochondrion . Lower abundance in mitochondrion than in cytoplasm. | |
Protein Description | Functions as a proapoptotic molecule through the caspase-dependent mitochondrial pathway of cell death.. | |
Protein Sequence | MVTLLPIEGQEIHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
53 | Phosphorylation | PLEALLGSNKEPMLP CHHHHHCCCCCCCCC | 44.70 | - | |
63 | Phosphorylation | EPMLPKETVLSLKRY CCCCCHHHHHHHHCC | 32.64 | - | |
66 | Phosphorylation | LPKETVLSLKRYNLG CCHHHHHHHHCCCCC | 27.75 | 24719451 | |
70 | Phosphorylation | TVLSLKRYNLGSSAM HHHHHHCCCCCCHHH | 17.10 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BLID_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BLID_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BLID_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
B2CL1_HUMAN | BCL2L1 | physical | 20400521 | |
BCL2_HUMAN | BCL2 | physical | 20400521 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...