| UniProt ID | BLID_HUMAN | |
|---|---|---|
| UniProt AC | Q8IZY5 | |
| Protein Name | BH3-like motif-containing cell death inducer | |
| Gene Name | BLID | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 108 | |
| Subcellular Localization | Cytoplasm . Mitochondrion . Lower abundance in mitochondrion than in cytoplasm. | |
| Protein Description | Functions as a proapoptotic molecule through the caspase-dependent mitochondrial pathway of cell death.. | |
| Protein Sequence | MVTLLPIEGQEIHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 53 | Phosphorylation | PLEALLGSNKEPMLP CHHHHHCCCCCCCCC | 44.70 | - | |
| 63 | Phosphorylation | EPMLPKETVLSLKRY CCCCCHHHHHHHHCC | 32.64 | - | |
| 66 | Phosphorylation | LPKETVLSLKRYNLG CCHHHHHHHHCCCCC | 27.75 | 24719451 | |
| 70 | Phosphorylation | TVLSLKRYNLGSSAM HHHHHHCCCCCCHHH | 17.10 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BLID_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BLID_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BLID_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| B2CL1_HUMAN | BCL2L1 | physical | 20400521 | |
| BCL2_HUMAN | BCL2 | physical | 20400521 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...