dbPTM

BH078_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	BH078_ARATH
UniProt AC	Q9FJL4
Protein Name	Transcription factor bHLH78
Gene Name	BHLH78
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	498
Subcellular Localization	Nucleus .
Protein Description	Transcription factor that binds DNA to G box 5'-CACGTG-3' and to E-box 5'-CANNTG-3' (By similarity). Binds to chromatin DNA of the FT gene and promotes its expression, and thus triggers flowering in response to blue light. [PubMed: 24130508]
Protein Sequence	MDNELFMNTEFPPPPEMATHFEHQQSSSSAMMLNWALMDPNPHQDSSFLWEKSTEQQQQQSIFDSALSSLVSSPTPSNSNFSGGGGDGFLIRELIGKLGNIGNNNNNSGEIYGTPMSRSASCYATPMSSPPPPTNSNSQMMMNRTTPLTEFSADPGFAERAARFSCFGSRSFNGRTNTNLPINNGNNMVNNSGKLTRVSSTPALKALVSPEVTPGGEFSRKRKSVPKGKSKENPISTASPSPSFSKTAEKNGGKGGSKSSEEKGGKRRREEEDDEEEEGEGEGNKSNNTKPPEPPKDYIHVRARRGQATDSHSLAERVRREKIGERMKLLQDLVPGCNKVTGKALMLDEIINYVQSLQRQVEFLSMKLSSVNDTRLDFNVDALVSKDVMIPSSNNRLHEEGLQSKSSSHHHQQQLNIYNNNSQLLPNISSNNMMLQSPMNSLETSTLARSFTHLPTLTQFTDSISQYQMFSEEDLQSIVGMGVAENPNNESQHMKIEL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
123	Phosphorylation	MSRSASCYATPMSSP CCCCCCCEECCCCCC	15.83	24894044
171	Phosphorylation	FSCFGSRSFNGRTNT HCEECCCCCCCCCCC	25.43	28011693
199	Phosphorylation	SGKLTRVSSTPALKA CCCEEEECCCHHHHH	25.79	30407730
200	Phosphorylation	GKLTRVSSTPALKAL CCEEEECCCHHHHHH	35.24	30407730
201	Phosphorylation	KLTRVSSTPALKALV CEEEECCCHHHHHHC	12.69	30407730
219	Phosphorylation	VTPGGEFSRKRKSVP CCCCCCCCCCCCCCC	32.37	24894044

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of BH078_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of BH078_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of BH078_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
HY5_ARATH	HY5	physical	19802365

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of BH078_ARATH

Related Literatures of Post-Translational Modification