BH063_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BH063_ARATH
• UniProt AC: Q8GY61
• Protein Name: Transcription factor bHLH63
• Gene Name: BHLH63
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 335
• Subcellular Localization: Nucleus .
• Protein Description: Transcription factor that binds DNA to G box 5'-CACGTG-3' and, to a lower extent, to E-box 5'-CANNTG-3' in vitro. Binds to chromatin DNA of the FT gene and promotes its expression, and thus triggers flowering in response to blue light..
• Protein Sequence: MNGAIGGDLLLNFPDMSVLERQRAHLKYLNPTFDSPLAGFFADSSMITGGEMDSYLSTAGLNLPMMYGETTVEGDSRLSISPETTLGTGNFKKRKFDTETKDCNEKKKKMTMNRDDLVEEGEEEKSKITEQNNGSTKSIKKMKHKAKKEENNFSNDSSKVTKELEKTDYIHVRARRGQATDSHSIAERVRREKISERMKFLQDLVPGCDKITGKAGMLDEIINYVQSLQRQIEFLSMKLAIVNPRPDFDMDDIFAKEVASTPMTVVPSPEMVLSGYSHEMVHSGYSSEMVNSGYLHVNPMQQVNTSSDPLSCFNNGEAPSMWDSHVQNLYGNLGV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of BH063_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BH063_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BH063_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BH063_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BH076_ARATH	CIB5	physical	24130508
BH078_ARATH	AT5G48560	physical	24130508
BH062_ARATH	AT3G07340	physical	24130508

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.