UniProt ID | BH020_ARATH | |
---|---|---|
UniProt AC | Q8S3F1 | |
Protein Name | Transcription factor NAI1 | |
Gene Name | NAI1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 320 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcription activator that regulates the expression of at least NAI2, PYK10 and PBP1. Required for and mediates the formation of endoplasmic reticulum bodies (ER bodies). Involved in the symbiotic interactions with the endophytes of the Sebacinaceae fungus family, such as Piriformospora indica and Sebacina.. | |
Protein Sequence | MDDSSFMDLMIDTDEYLIDDWESDFPICGETNTNPGSESGSGTGFELLAERPTKQMKTNNNMNSTSSSPSSSSSSGSRTSQVISFGSPDTKTNPVETSLNFSNQVSMDQKVGSKRKDCVNNGGRREPHLLKEHVLAERKRRQKLNERLIALSALLPGLKKTDKATVLEDAIKHLKQLQERVKKLEEERVVTKKMDQSIILVKRSQVYLDDDSSSYSSTCSAASPLSSSSDEVSIFKQTMPMIEARVSDRDLLIRVHCEKNKGCMIKILSSLEKFRLEVVNSFTLPFGNSTLVITILTKMDNKFSRPVEEVVKNIRVALAE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of BH020_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BH020_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BH020_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BH020_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BH020_ARATH | NAI1 | physical | 16867983 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...