dbPTM

BH020_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	BH020_ARATH
UniProt AC	Q8S3F1
Protein Name	Transcription factor NAI1
Gene Name	NAI1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	320
Subcellular Localization	Nucleus .
Protein Description	Transcription activator that regulates the expression of at least NAI2, PYK10 and PBP1. Required for and mediates the formation of endoplasmic reticulum bodies (ER bodies). Involved in the symbiotic interactions with the endophytes of the Sebacinaceae fungus family, such as Piriformospora indica and Sebacina..
Protein Sequence	MDDSSFMDLMIDTDEYLIDDWESDFPICGETNTNPGSESGSGTGFELLAERPTKQMKTNNNMNSTSSSPSSSSSSGSRTSQVISFGSPDTKTNPVETSLNFSNQVSMDQKVGSKRKDCVNNGGRREPHLLKEHVLAERKRRQKLNERLIALSALLPGLKKTDKATVLEDAIKHLKQLQERVKKLEEERVVTKKMDQSIILVKRSQVYLDDDSSSYSSTCSAASPLSSSSDEVSIFKQTMPMIEARVSDRDLLIRVHCEKNKGCMIKILSSLEKFRLEVVNSFTLPFGNSTLVITILTKMDNKFSRPVEEVVKNIRVALAE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of BH020_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of BH020_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of BH020_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of BH020_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
BH020_ARATH	NAI1	physical	16867983

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of BH020_ARATH

Related Literatures of Post-Translational Modification