BET11_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BET11_ARATH
• UniProt AC: Q9M2J9
• Protein Name: Bet1-like SNARE 1-1
• Gene Name: BET11
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 122
• Subcellular Localization: Golgi apparatus membrane; Single-pass type IV membrane protein. Endoplasmic reticulum membrane; Single-pass type IV membrane protein.
• Protein Description: Required for vesicular transport from the ER to the Golgi complex. Functions as a SNARE associated with ER-derived vesicles (By similarity)..
• Protein Sequence: MNPRREPRGGRSSLFDGIEEGGIRAASSYSHEINEHENERALEGLQDRVILLKRLSGDINEEVDTHNRMLDRMGNDMDSSRGFLSGTMDRFKTVFETKSSRRMLTLVASFVGLFLVIYYLTR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
12	Phosphorylation	REPRGGRSSLFDGIE CCCCCCCCCCCCCHH	34.37	29654922
13	Phosphorylation	EPRGGRSSLFDGIEE CCCCCCCCCCCCHHH	31.52	29654922
27	Phosphorylation	EGGIRAASSYSHEIN HCCCHHHHHCCCCCC	28.91	25561503
28	Phosphorylation	GGIRAASSYSHEINE CCCHHHHHCCCCCCH	26.40	30407730
29	Phosphorylation	GIRAASSYSHEINEH CCHHHHHCCCCCCHH	16.14	25561503
30	Phosphorylation	IRAASSYSHEINEHE CHHHHHCCCCCCHHC	19.32	29654922
56	Phosphorylation	VILLKRLSGDINEEV HHHHHHHHCCCCHHH	38.15	30291188
65	Phosphorylation	DINEEVDTHNRMLDR CCCHHHHHHHHHHHH	26.65	29654922

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BET11_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BET11_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BET11_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NAC89_ARATH	NAC089	physical	21798944
VAP11_ARATH	VAP	physical	21798944
Y4645_ARATH	AT4G26450	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Site-specific phosphorylation profiling of Arabidopsis proteins bymass spectrometry and peptide chip analysis.";
de la Fuente van Bentem S., Anrather D., Dohnal I., Roitinger E.,Csaszar E., Joore J., Buijnink J., Carreri A., Forzani C.,Lorkovic Z.J., Barta A., Lecourieux D., Verhounig A., Jonak C.,Hirt H.;
J. Proteome Res. 7:2458-2470(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-56, AND MASSSPECTROMETRY.
PubMed: 18433157