dbPTM

BBX20_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	BBX20_ARATH
UniProt AC	Q0IGM7
Protein Name	B-box zinc finger protein 20 {ECO:0000303\|PubMed:19920209}
Gene Name	BBX20 {ECO:0000303\|PubMed:19920209}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	242
Subcellular Localization	Nucleus .
Protein Description	Acts as positive regulator of seedling photomorphogenesis. Plays a negative role in brassinosteroid responses..
Protein Sequence	MKIWCAVCDKEEASVFCCADEAALCNGCDRHVHFANKLAGKHLRFSLTSPTFKDAPLCDICGERRALLFCQEDRAILCRECDIPIHQANEHTKKHNRFLLTGVKISASPSAYPRASNSNSAAAFGRAKTRPKSVSSEVPSSASNEVFTSSSSTTTSNCYYGIEENYHHVSDSGSGSGCTGSISEYLMETLPGWRVEDLLEHPSCVSYEDNIITNNNNSESYRVYDGSSQFHHQGFWDHKPFS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
116	Phosphorylation	PSAYPRASNSNSAAA CCCCCCCCCCCCHHH	41.91	24894044
118	Phosphorylation	AYPRASNSNSAAAFG CCCCCCCCCCHHHHC	29.66	24894044

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of BBX20_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of BBX20_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of BBX20_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
MED25_ARATH	PFT1	physical	22822211

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of BBX20_ARATH

Related Literatures of Post-Translational Modification