BBIP1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BBIP1_HUMAN
• UniProt AC: A8MTZ0
• Protein Name: BBSome-interacting protein 1
• Gene Name: BBIP1
• Organism: Homo sapiens (Human).
• Sequence Length: 92
• Subcellular Localization: Cell projection, cilium . Cytoplasm . Localizes inside the primary cilium but not at centriolar satellites.
• Protein Description: The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP exchange factor, which localizes to the basal body and contacts the BBSome. Rab8(GTP) enters the primary cilium and promotes extension of the ciliary membrane. Firstly the BBSome associates with the ciliary membrane and binds to RAB3IP/Rabin8, the guanosyl exchange factor (GEF) for Rab8 and then the Rab8-GTP localizes to the cilium and promotes docking and fusion of carrier vesicles to the base of the ciliary membrane. Required for primary cilia assembly and BBSome stability. Regulates cytoplasmic microtubule stability and acetylation..
• Protein Sequence: MLKAAAKRPELSGKNTISNNSDMAEVKSMFREVLPKQGPLFVEDIMTMVLCKPKLLPLKSLTLEKLEKMHQAAQNTIRQQEMAEKDQRQITH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
12 (in isoform 3)	Phosphorylation	-	46.16	24719451
28	Phosphorylation	SDMAEVKSMFREVLP CCHHHHHHHHHHHCH	28.47	-
75 (in isoform 4)	Phosphorylation	-	32.52	25907765
78 (in isoform 4)	Phosphorylation	-	30.05	25907765
85 (in isoform 4)	Phosphorylation	-	50.01	25907765
85	Acetylation	RQQEMAEKDQRQITH HHHHHHHHHHHHCCC	50.01	25953088
86 (in isoform 4)	Phosphorylation	-	40.16	25907765
87 (in isoform 4)	Phosphorylation	-	50.69	25907765

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BBIP1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BBIP1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BBIP1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BBS5_HUMAN	BBS5	physical	27173435
TTC8_HUMAN	TTC8	physical	27173435

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.