BAF_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BAF_DROME
• UniProt AC: Q9VLU0
• Protein Name: Barrier-to-autointegration factor
• Gene Name: baf
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 90
• Subcellular Localization: Nucleus . Cytoplasm . Chromosome . Colocalizes with chromosomes during both interphase and mitosis.
• Protein Description: Plays fundamental roles in nuclear assembly, chromatin organization, gene expression and gonad development. May potently compress chromatin structure and be involved in membrane recruitment and chromatin decondensation during nuclear assembly. Functions are required in both M phase and interphase of the cell cycle..
• Protein Sequence: MSGTSQKHRNFVAEPMGNKSVTELAGIGETLGGRLKDAGFDMAYTVLGQYLVLKKDEELFKDWMKEVCHASSKQASDCYNCLNDWCEEFL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MSGTSQKHRNF ----CCCCCHHHHCC	22.22	27794539
5	Phosphorylation	---MSGTSQKHRNFV ---CCCCCHHHHCCC	40.53	27794539
20	Phosphorylation	AEPMGNKSVTELAGI CCCCCCCCHHHHHCC	37.97	19060867
22	Phosphorylation	PMGNKSVTELAGIGE CCCCCCHHHHHCCCH	32.16	19060867
30	Phosphorylation	ELAGIGETLGGRLKD HHHCCCHHHCHHHHH	26.03	22668510
65	Acetylation	ELFKDWMKEVCHASS HHHHHHHHHHHHHCC	42.62	21791702

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BAF_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BAF_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BAF_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
3BP5H_DROME	pcs	physical	14605208
FEM1B_DROME	Fem-1	physical	14605208
ORN_DROME	CG10214	physical	22036573

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.