UniProt ID | AXR1_ARATH | |
---|---|---|
UniProt AC | P42744 | |
Protein Name | NEDD8-activating enzyme E1 regulatory subunit AXR1 {ECO:0000305} | |
Gene Name | AXR1 {ECO:0000303|PubMed:8321287} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 540 | |
Subcellular Localization | Nucleus . | |
Protein Description | Regulatory subunit of the dimeric ECR1-AXR1 E1 enzyme. E1 activates RUB1/NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a RUB1-ECR1 thioester and free AMP. E1 finally transfers RUB1 to the catalytic cysteine of RCE1. Plays an important role in auxin response. [PubMed: 8321287 Regulates the chromosomal localization of meiotic recombination by crossovers (COs) and subsequent synapsis, probably through the activation of a CRL4 complex] | |
Protein Sequence | MQAVKRSRRHVEEEPTMVEPKTKYDRQLRIWGEVGQAALEEASICLLNCGPTGSEALKNLVLGGVGSITVVDGSKVQFGDLGNNFMVDAKSVGQSKAKSVCAFLQELNDSVNAKFIEENPDTLITTNPSFFSQFTLVIATQLVEDSMLKLDRICRDANVKLVLVRSYGLAGFVRISVKEHPIIDSKPDHFLDDLRLNNPWPELKSFVETIDLNVSEPAAAHKHIPYVVILVKMAEEWAQSHSGNLPSTREEKKEFKDLVKSKMVSTDEDNYKEAIEAAFKVFAPRGISSEVQKLINDSCAEVNSNSSAFWVMVAALKEFVLNEGGGEAPLEGSIPDMTSSTEHYINLQKIYLAKAEADFLVIEERVKNILKKIGRDPSSIPKPTIKSFCKNARKLKLCRYRMVEDEFRNPSVTEIQKYLADEDYSGAMGFYILLRAADRFAANYNKFPGQFDGGMDEDISRLKTTALSLLTDLGCNGSVLPDDLIHEMCRFGASEIHVVSAFVGGIASQEVIKLVTKQFVPMLGTYIFNGIDHKSQLLKL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
67 | Phosphorylation | LVLGGVGSITVVDGS HHCCCCCEEEEECCC | 28011693 | ||
69 | Phosphorylation | LGGVGSITVVDGSKV CCCCCEEEEECCCEE | 28011693 | ||
378 | Phosphorylation | KKIGRDPSSIPKPTI HHHCCCHHHCCCHHH | 25561503 | ||
379 | Phosphorylation | KIGRDPSSIPKPTIK HHCCCHHHCCCHHHH | 25561503 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AXR1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AXR1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AXR1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RCE1_ARATH | RCE1 | physical | 12682009 | |
RUB1_ARATH | RUB1 | physical | 25783028 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...