| UniProt ID | ATP4B_HUMAN | |
|---|---|---|
| UniProt AC | P51164 | |
| Protein Name | Potassium-transporting ATPase subunit beta | |
| Gene Name | ATP4B | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 291 | |
| Subcellular Localization |
Cell membrane Single-pass type II membrane protein. |
|
| Protein Description | Required for stabilization and maturation of the catalytic proton pump alpha subunit and may also involved in cell adhesion and establishing epithelial cell polarity.. | |
| Protein Sequence | MAALQEKKTCGQRMEEFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 79 | Phosphorylation | DYQDQLRSPGVTLRP CHHHHHCCCCCCCCC | 34.30 | - | |
| 83 | Phosphorylation | QLRSPGVTLRPDVYG HHCCCCCCCCCCCCC | 23.98 | - | |
| 89 | Phosphorylation | VTLRPDVYGEKGLEI CCCCCCCCCCCCEEE | 27.26 | - | |
| 98 | Phosphorylation | EKGLEIVYNVSDNRT CCCEEEEEECCCCCC | 18.60 | - | |
| 99 | N-linked_Glycosylation | KGLEIVYNVSDNRTW CCEEEEEECCCCCCH | 18.87 | 10722662 | |
| 99 | N-linked_Glycosylation | KGLEIVYNVSDNRTW CCEEEEEECCCCCCH | 18.87 | 10722662 | |
| 103 | N-linked_Glycosylation | IVYNVSDNRTWADLT EEEECCCCCCHHHHH | 35.46 | UniProtKB CARBOHYD | |
| 103 | N-linked_Glycosylation | IVYNVSDNRTWADLT EEEECCCCCCHHHHH | 35.46 | 10722662 | |
| 130 | N-linked_Glycosylation | AAQEDSINCTSEQYF HCCCCCCCCCCCCEE | 27.28 | UniProtKB CARBOHYD | |
| 130 | N-linked_Glycosylation | AAQEDSINCTSEQYF HCCCCCCCCCCCCEE | 27.28 | 10722662 | |
| 146 | N-linked_Glycosylation | QESFRAPNHTKFSCK HHHHCCCCCCCEEEE | 55.25 | UniProtKB CARBOHYD | |
| 146 | N-linked_Glycosylation | QESFRAPNHTKFSCK HHHHCCCCCCCEEEE | 55.25 | 10722662 | |
| 161 | N-linked_Glycosylation | FTADMLQNCSGLADP EHHHHHHHCCCCCCC | 20.26 | UniProtKB CARBOHYD | |
| 161 | N-linked_Glycosylation | FTADMLQNCSGLADP EHHHHHHHCCCCCCC | 20.26 | 10722662 | |
| 193 | N-linked_Glycosylation | IVKFLPSNGSAPRVD EEECCCCCCCCCCCE | 46.64 | UniProtKB CARBOHYD | |
| 193 | N-linked_Glycosylation | IVKFLPSNGSAPRVD EEECCCCCCCCCCCE | 46.64 | 10722662 | |
| 222 | N-linked_Glycosylation | QVKYYPPNGTFSLHY EEEEECCCCEEEEEE | 58.60 | 10722662 | |
| 222 | N-linked_Glycosylation | QVKYYPPNGTFSLHY EEEEECCCCEEEEEE | 58.60 | UniProtKB CARBOHYD | |
| 235 | Ubiquitination | HYFPYYGKKAQPHYS EEECCCCCCCCCCCC | 28.90 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATP4B_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATP4B_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATP4B_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| AGO3_HUMAN | AGO3 | physical | 21988832 | |
| PMGE_HUMAN | BPGM | physical | 21988832 | |
| CCDB1_HUMAN | CCNDBP1 | physical | 25416956 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| D00355 | Lansoprazole (JAN/USP/INN); Prevacid (TN) | |||||
| D00455 | Omeprazole (JP16/USP/INN); Prilosec (TN) | |||||
| D00724 | Sodium rabeprazole (JP16); Rabeprazole sodium (USAN); Aciphex (TN); Pariet (TN) | |||||
| D01207 | Omeprazole sodium (USAN); Losec sodium (TN) | |||||
| D01920 | Tenatoprazole (JAN/INN); TU 199 | |||||
| D01984 | Esomeprazole magnesium hydrate (JAN); Esomeprazole magnesium (USAN); Nexium (TN) | |||||
| D02593 | Pantoprazole Sodium Hydrate (JAN); Pantoprazole sodium (USAN); Protonix (TN) | |||||
| D04056 | Esomeprazole sodium (USAN); Nexium IV (TN) | |||||
| D05259 | Omeprazole magnesium (USAN); Prilosec OTC (TN) | |||||
| D05261 | Omeprazole sodium injection (JAN); Omeprazole sodium hydrate; Omepral (TN) | |||||
| D05353 | Pantoprazole (USAN/INN) | |||||
| D05900 | Timoprazole (INN) | |||||
| D05901 | Picoprazole (INN) | |||||
| D05906 | Leminoprazole (INN) | |||||
| D07917 | Esomeprazole (INN); Inexium paranova (TN) | |||||
| D08463 | Rabeprazole (INN); Eraloc (TN) | |||||
| D08903 | Dexlansoprazole (INN/USAN) | |||||
| D09339 | Esomeprazole potassium (USAN) | |||||
| D10120 | Esomeprazole strontium (USAN); Esomeprazole strontium tetrahydrate | |||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
