UniProt ID | ATP4B_HUMAN | |
---|---|---|
UniProt AC | P51164 | |
Protein Name | Potassium-transporting ATPase subunit beta | |
Gene Name | ATP4B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 291 | |
Subcellular Localization |
Cell membrane Single-pass type II membrane protein. |
|
Protein Description | Required for stabilization and maturation of the catalytic proton pump alpha subunit and may also involved in cell adhesion and establishing epithelial cell polarity.. | |
Protein Sequence | MAALQEKKTCGQRMEEFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
79 | Phosphorylation | DYQDQLRSPGVTLRP CHHHHHCCCCCCCCC | 34.30 | - | |
83 | Phosphorylation | QLRSPGVTLRPDVYG HHCCCCCCCCCCCCC | 23.98 | - | |
89 | Phosphorylation | VTLRPDVYGEKGLEI CCCCCCCCCCCCEEE | 27.26 | - | |
98 | Phosphorylation | EKGLEIVYNVSDNRT CCCEEEEEECCCCCC | 18.60 | - | |
99 | N-linked_Glycosylation | KGLEIVYNVSDNRTW CCEEEEEECCCCCCH | 18.87 | 10722662 | |
99 | N-linked_Glycosylation | KGLEIVYNVSDNRTW CCEEEEEECCCCCCH | 18.87 | 10722662 | |
103 | N-linked_Glycosylation | IVYNVSDNRTWADLT EEEECCCCCCHHHHH | 35.46 | UniProtKB CARBOHYD | |
103 | N-linked_Glycosylation | IVYNVSDNRTWADLT EEEECCCCCCHHHHH | 35.46 | 10722662 | |
130 | N-linked_Glycosylation | AAQEDSINCTSEQYF HCCCCCCCCCCCCEE | 27.28 | UniProtKB CARBOHYD | |
130 | N-linked_Glycosylation | AAQEDSINCTSEQYF HCCCCCCCCCCCCEE | 27.28 | 10722662 | |
146 | N-linked_Glycosylation | QESFRAPNHTKFSCK HHHHCCCCCCCEEEE | 55.25 | UniProtKB CARBOHYD | |
146 | N-linked_Glycosylation | QESFRAPNHTKFSCK HHHHCCCCCCCEEEE | 55.25 | 10722662 | |
161 | N-linked_Glycosylation | FTADMLQNCSGLADP EHHHHHHHCCCCCCC | 20.26 | UniProtKB CARBOHYD | |
161 | N-linked_Glycosylation | FTADMLQNCSGLADP EHHHHHHHCCCCCCC | 20.26 | 10722662 | |
193 | N-linked_Glycosylation | IVKFLPSNGSAPRVD EEECCCCCCCCCCCE | 46.64 | UniProtKB CARBOHYD | |
193 | N-linked_Glycosylation | IVKFLPSNGSAPRVD EEECCCCCCCCCCCE | 46.64 | 10722662 | |
222 | N-linked_Glycosylation | QVKYYPPNGTFSLHY EEEEECCCCEEEEEE | 58.60 | 10722662 | |
222 | N-linked_Glycosylation | QVKYYPPNGTFSLHY EEEEECCCCEEEEEE | 58.60 | UniProtKB CARBOHYD | |
235 | Ubiquitination | HYFPYYGKKAQPHYS EEECCCCCCCCCCCC | 28.90 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATP4B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATP4B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATP4B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AGO3_HUMAN | AGO3 | physical | 21988832 | |
PMGE_HUMAN | BPGM | physical | 21988832 | |
CCDB1_HUMAN | CCNDBP1 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
D00355 | Lansoprazole (JAN/USP/INN); Prevacid (TN) | |||||
D00455 | Omeprazole (JP16/USP/INN); Prilosec (TN) | |||||
D00724 | Sodium rabeprazole (JP16); Rabeprazole sodium (USAN); Aciphex (TN); Pariet (TN) | |||||
D01207 | Omeprazole sodium (USAN); Losec sodium (TN) | |||||
D01920 | Tenatoprazole (JAN/INN); TU 199 | |||||
D01984 | Esomeprazole magnesium hydrate (JAN); Esomeprazole magnesium (USAN); Nexium (TN) | |||||
D02593 | Pantoprazole Sodium Hydrate (JAN); Pantoprazole sodium (USAN); Protonix (TN) | |||||
D04056 | Esomeprazole sodium (USAN); Nexium IV (TN) | |||||
D05259 | Omeprazole magnesium (USAN); Prilosec OTC (TN) | |||||
D05261 | Omeprazole sodium injection (JAN); Omeprazole sodium hydrate; Omepral (TN) | |||||
D05353 | Pantoprazole (USAN/INN) | |||||
D05900 | Timoprazole (INN) | |||||
D05901 | Picoprazole (INN) | |||||
D05906 | Leminoprazole (INN) | |||||
D07917 | Esomeprazole (INN); Inexium paranova (TN) | |||||
D08463 | Rabeprazole (INN); Eraloc (TN) | |||||
D08903 | Dexlansoprazole (INN/USAN) | |||||
D09339 | Esomeprazole potassium (USAN) | |||||
D10120 | Esomeprazole strontium (USAN); Esomeprazole strontium tetrahydrate | |||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...