dbPTM

ATG5_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ATG5_DROME
UniProt AC	Q9W3R7
Protein Name	Autophagy protein 5
Gene Name	Atg5
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	269
Subcellular Localization	Cytoplasm. Preautophagosomal structure membrane Peripheral membrane protein.
Protein Description	Involved in autophagic vesicle formation. Conjugation with Atg12, through a ubiquitin-like conjugating system involving Atg7 as an E1-like activating enzyme and Atg10 as an E2-like conjugating enzyme, is essential for its function. The Atg12-Atg5 conjugate acts as an E3-like enzyme which is required for lipidation of Atg8 and its association to the vesicle membranes (By similarity)..
Protein Sequence	MAHDREVLRMIWEGQIGICFQADRDEIVGIKPEPFYLMISRLSYLPLVTDKVRKYFSRYISAEHQDGAVWFDFNGTPLRLHYPIGVLYDLLHPEEDSTPWCLTIHFSKFPEDMLVKLNSKELLESHYMSCLKEADVLKHRGLVISAMQKKDHNQLWLGLVNEKFDQFWAVNRRLMEPYGDLESFKNIPLRIYTDDDFTYTQKLISPISVGGQKKSLADLMAELSTPVRRAVGCRTHGIDLHEETQLQWMSEHLSYPDNFLHLSVDYKDV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
205	Phosphorylation	TYTQKLISPISVGGQ CCEEEEECCEECCCC	26.98	27794539

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ATG5_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ATG5_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ATG5_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
FEM1B_DROME	Fem-1	physical	14605208
KPC3_DROME	Pkc98E	physical	14605208
NDUAA_DROME	ND42	physical	14605208
RS3_DROME	RpS3	physical	14605208

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ATG5_DROME

Related Literatures of Post-Translational Modification