UniProt ID | ATG12_MOUSE | |
---|---|---|
UniProt AC | Q9CQY1 | |
Protein Name | Ubiquitin-like protein ATG12 | |
Gene Name | Atg12 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 141 | |
Subcellular Localization |
Cytoplasm. Preautophagosomal structure membrane Peripheral membrane protein . TECPR1 recruits the ATG12-ATG5 conjugate to the autolysosomal membrane. |
|
Protein Description | Ubiquitin-like protein involved in autophagy vesicles formation. Conjugation with ATG5 through a ubiquitin-like conjugating system involving also ATG7 as an E1-like activating enzyme and ATG10 as an E2-like conjugating enzyme, is essential for its function. The ATG12-ATG5 conjugate acts as an E3-like enzyme which is required for lipidation of ATG8 family proteins and their association to the vesicle membranes.; (Microbial infection) May act as a proviral factor. In association with ATG5, negatively regulates the innate antiviral immune response by impairing the type I IFN production pathway upon vesicular stomatitis virus (VSV) infection.. | |
Protein Sequence | MSEDSEVVLQLPSAPVGAGGESLPELSPETATPEPPSSAAVSPGTEEPPGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
27 | Phosphorylation | GESLPELSPETATPE CCCCCCCCCCCCCCC | 21.01 | 25338131 | |
30 | Phosphorylation | LPELSPETATPEPPS CCCCCCCCCCCCCCC | 38.93 | 25338131 | |
42 | Phosphorylation | PPSSAAVSPGTEEPP CCCCCCCCCCCCCCC | 16.94 | 25338131 | |
70 | Malonylation | VGDTPIMKTKKWAVE HCCCCCCCCCCHHHH | 58.89 | 26320211 | |
90 | Ubiquitination | QGLIDFIKKFLKLVA HHHHHHHHHHHHHHH | 37.15 | 22790023 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATG12_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATG12_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATG12_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ATG5_MOUSE | Atg5 | physical | 12482611 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...