ATG12_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ATG12_MOUSE
• UniProt AC: Q9CQY1
• Protein Name: Ubiquitin-like protein ATG12
• Gene Name: Atg12
• Organism: Mus musculus (Mouse).
• Sequence Length: 141
• Subcellular Localization: Cytoplasm. Preautophagosomal structure membrane ; Peripheral membrane protein . TECPR1 recruits the ATG12-ATG5 conjugate to the autolysosomal membrane.
• Protein Description: Ubiquitin-like protein involved in autophagy vesicles formation. Conjugation with ATG5 through a ubiquitin-like conjugating system involving also ATG7 as an E1-like activating enzyme and ATG10 as an E2-like conjugating enzyme, is essential for its function. The ATG12-ATG5 conjugate acts as an E3-like enzyme which is required for lipidation of ATG8 family proteins and their association to the vesicle membranes.; (Microbial infection) May act as a proviral factor. In association with ATG5, negatively regulates the innate antiviral immune response by impairing the type I IFN production pathway upon vesicular stomatitis virus (VSV) infection..
• Protein Sequence: MSEDSEVVLQLPSAPVGAGGESLPELSPETATPEPPSSAAVSPGTEEPPGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
27	Phosphorylation	GESLPELSPETATPE CCCCCCCCCCCCCCC	21.01	25338131
30	Phosphorylation	LPELSPETATPEPPS CCCCCCCCCCCCCCC	38.93	25338131
42	Phosphorylation	PPSSAAVSPGTEEPP CCCCCCCCCCCCCCC	16.94	25338131
70	Malonylation	VGDTPIMKTKKWAVE HCCCCCCCCCCHHHH	58.89	26320211
90	Ubiquitination	QGLIDFIKKFLKLVA HHHHHHHHHHHHHHH	37.15	22790023

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ATG12_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ATG12_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ATG12_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ATG5_MOUSE	Atg5	physical	12482611

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.