ATF3_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ATF3_MOUSE
• UniProt AC: Q60765
• Protein Name: Cyclic AMP-dependent transcription factor ATF-3
• Gene Name: Atf3
• Organism: Mus musculus (Mouse).
• Sequence Length: 181
• Subcellular Localization: Nucleus.
• Protein Description: This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing the binding of inhibitory cofactors at the promoter (By similarity)..
• Protein Sequence: MMLQHPGQVSASEVSATAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVNNRPLEMSVTKSEAAPEEDERKRRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
42	Sumoylation	ANLTPFVKEELRFAI CCCCHHHHHHHHHHH	45.94	-
162	Phosphorylation	VRAQNGRTPEDERNL EECCCCCCCHHHHHH	32.21	26824392

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ATF3_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ATF3_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ATF3_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
JUN_MOUSE	Jun	physical	21304988
HDAC2_MOUSE	Hdac2	physical	22989952

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.