ASF1B_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ASF1B_MOUSE
• UniProt AC: Q9DAP7
• Protein Name: Histone chaperone ASF1B
• Gene Name: Asf1b
• Organism: Mus musculus (Mouse).
• Sequence Length: 202
• Subcellular Localization: Nucleus .
• Protein Description: Histone chaperone that facilitates histone deposition and histone exchange and removal during nucleosome assembly and disassembly. Cooperates with chromatin assembly factor 1 (CAF-1) to promote replication-dependent chromatin assembly. Does not participate in replication-independent nucleosome deposition which is mediated by ASF1A and HIRA..
• Protein Sequence: MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALSDDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYPDPELRENPPPKPDFSQLQRNILASNPRVTRFHINWDNNPDSLEAIENQDPNVDFSLSLSCTPVKSLGLPSCIPGLLPENSMDCI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
133	Phosphorylation	PPPKPDFSQLQRNIL CCCCCCHHHHHHHHH	37.04	27180971
159	Phosphorylation	NWDNNPDSLEAIENQ ECCCCHHHHHHHHCC	29.39	26643407
173	Phosphorylation	QDPNVDFSLSLSCTP CCCCCCEEEEEECCC	16.76	26643407
175	Phosphorylation	PNVDFSLSLSCTPVK CCCCEEEEEECCCCH	19.62	26643407
177	Phosphorylation	VDFSLSLSCTPVKSL CCEEEEEECCCCHHH	16.75	26643407
179	Phosphorylation	FSLSLSCTPVKSLGL EEEEEECCCCHHHCC	27.95	26643407
198	Phosphorylation	PGLLPENSMDCI--- CCCCCCCCCCCC---	17.84	24453211

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
198	S	Phosphorylation	Kinase	TLK2	O55047	Uniprot

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ASF1B_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ASF1B_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CAF1A_MOUSE	Chaf1a	physical	26365490

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.