dbPTM

ASB12_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ASB12_MOUSE
UniProt AC	Q9D738
Protein Name	Ankyrin repeat and SOCS box protein 12
Gene Name	Asb12
Organism	Mus musculus (Mouse).
Sequence Length	308
Subcellular Localization
Protein Description	Probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins..
Protein Sequence	MNLMDIAKIFSLLQPEKEEEDTGTGEKQALNQAVYDNDSCTLDHLLHQERYKRFINSRSGWGIPGTPLRLAASYGHLNCVKVLLEHGADVDSLDVKAQTPLFTAVSHGHLECVRMLLEAGACPSGSIYNNCSPVLTASRDGAFAILQELLGHGAEANVKAKLPVWASNIASCSGPLYLAAVYGHLDCFRLLLLYGADPDYNCTDQGLLSRVPQPRTLLEICLHHNCEPEYIQLLIDFGANIYLPSLPVDPTSQDDKGIKLLLQARATPRSLLSQTRLVIRRSLCRANQSQATDQLDIPPVLISYLKHQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of ASB12_MOUSE !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ASB12_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ASB12_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ASB12_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
MYCD_MOUSE	Myocd	physical	20211142

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ASB12_MOUSE

Related Literatures of Post-Translational Modification