UniProt ID | ARL_ARATH | |
---|---|---|
UniProt AC | Q8RXL7 | |
Protein Name | ARGOS-like protein | |
Gene Name | ARL | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 135 | |
Subcellular Localization |
Membrane Multi-pass membrane protein. Nucleus. Cytoplasm. Endoplasmic reticulum . |
|
Protein Description | Promotes cell expansion-dependent organ growth, probably via a brassinosteroids signaling pathway. Acts downstream of BRI1.. | |
Protein Sequence | MIREFSSLQNDIINIQEHYSLNNNMDVRGDHNRKNTSFRGSAPAPIMGKQELFRTLSSQNSPRRLISASYFSLESMVVLVGLTASLLILPLILPPLPPPPFMLLLIPIGIMVLLMVLAFMPSSNSKHVSSSSTFM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
55 | Phosphorylation | GKQELFRTLSSQNSP CHHHHHHHHCCCCCC | 25561503 | ||
57 | Phosphorylation | QELFRTLSSQNSPRR HHHHHHHCCCCCCCH | 25561503 | ||
58 | Phosphorylation | ELFRTLSSQNSPRRL HHHHHHCCCCCCCHH | 25561503 | ||
61 | Phosphorylation | RTLSSQNSPRRLISA HHHCCCCCCCHHHHH | 25561503 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARL_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARL_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARL_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NAC89_ARATH | NAC089 | physical | 21798944 | |
NIP11_ARATH | NLM1 | physical | 21798944 | |
NUP35_ARATH | AT3G16310 | physical | 21798944 | |
Y4645_ARATH | AT4G26450 | physical | 21798944 | |
VAP11_ARATH | VAP | physical | 21798944 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...