ARL5A_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ARL5A_HUMAN
• UniProt AC: Q9Y689
• Protein Name: ADP-ribosylation factor-like protein 5A
• Gene Name: ARL5A
• Organism: Homo sapiens (Human).
• Sequence Length: 179
• Protein Description: Lacks ADP-ribosylation enhancing activity..
• Protein Sequence: MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	N-myristoyl glycine	------MGILFTRIW ------CCCHHHHHH	25.88	-
2	Myristoylation	------MGILFTRIW ------CCCHHHHHH	25.88	-
44	Phosphorylation	SMNEVVHTSPTIGSN ECCCCEECCCCCCCC	25.45	29978859
45	Phosphorylation	MNEVVHTSPTIGSNV CCCCEECCCCCCCCC	12.74	29978859
47	Phosphorylation	EVVHTSPTIGSNVEE CCEECCCCCCCCCEE	37.42	29978859
50	Phosphorylation	HTSPTIGSNVEEIVI ECCCCCCCCCEEEEE	33.57	29978859
60	Phosphorylation	EEIVINNTRFLMWDI EEEEEECCCEEEEEC	20.50	29978859
81	Phosphorylation	RSSWNTYYTNTEFVI HHHCEEEECCCEEEE	7.47	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ARL5A_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ARL5A_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ARL5A_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CBX1_HUMAN	CBX1	physical	12414990
CBX5_HUMAN	CBX5	physical	12414990
CBX3_HUMAN	CBX3	physical	12414990
IMA1_HUMAN	KPNA2	physical	12414990
A4_HUMAN	APP	physical	21832049

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.