UniProt ID | ARF6_MOUSE | |
---|---|---|
UniProt AC | P62331 | |
Protein Name | ADP-ribosylation factor 6 | |
Gene Name | Arf6 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 175 | |
Subcellular Localization |
Cytoplasm, cytosol . Cell membrane Lipid-anchor . Endosome membrane Lipid-anchor . Recycling endosome membrane Lipid-anchor . Cell projection, filopodium membrane Lipid-anchor. Cell projection, ruffle . Cleavage furrow . Midbody, Midbody ring . Golg |
|
Protein Description | GTP-binding protein involved in protein trafficking that regulates endocytic recycling and cytoskeleton remodeling. Required for normal completion of mitotic cytokinesis. May also modulate vesicle budding and uncoating within the Golgi apparatus. Involved in the regulation of dendritic spine development, contributing to the regulation of dendritic branching and filopodia extension. Plays an important role in membrane trafficking, during junctional remodeling and epithelial polarization. Regulates surface levels of adherens junction proteins such as CDH1. [PubMed: 29420262] | |
Protein Sequence | MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGKVLSKIF ------CCCHHHHHH | 28.87 | - | |
7 | Acetylation | -MGKVLSKIFGNKEM -CCCHHHHHHCCHHH | 37.58 | 22826441 | |
12 | Acetylation | LSKIFGNKEMRILML HHHHHCCHHHEEEEE | 53.95 | 19852611 | |
31 | Phosphorylation | AGKTTILYKLKLGQS CCCEEEEEEEECCCC | 15.49 | - | |
32 | Ubiquitination | GKTTILYKLKLGQSV CCEEEEEEEECCCCE | 35.38 | - | |
34 | Ubiquitination | TTILYKLKLGQSVTT EEEEEEEECCCCEEE | 46.55 | 22790023 | |
41 | Phosphorylation | KLGQSVTTIPTVGFN ECCCCEEECCCCCEE | 23.85 | 25338131 | |
54 | Phosphorylation | FNVETVTYKNVKFNV EEEEEEEEECEEEEE | 9.02 | 29514104 | |
55 | Ubiquitination | NVETVTYKNVKFNVW EEEEEEEECEEEEEE | 45.99 | - | |
58 | Acetylation | TVTYKNVKFNVWDVG EEEEECEEEEEEECC | 40.38 | 22826441 | |
69 | Acetylation | WDVGGQDKIRPLWRH EECCCCCCCCCCCHH | 32.50 | - | |
69 | Ubiquitination | WDVGGQDKIRPLWRH EECCCCCCCCCCCHH | 32.50 | 22790023 | |
138 | Ubiquitination | KPHEIQEKLGLTRIR CHHHHHHHHCCCCCC | 31.32 | 22790023 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARF6_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARF6_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARF6_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GGA3_HUMAN | GGA3 | physical | 18162163 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...