ARF3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ARF3_ARATH
• UniProt AC: P40940
• Protein Name: ADP-ribosylation factor 3
• Gene Name: ARF3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 182
• Subcellular Localization: Golgi apparatus .
• Protein Description: GTP-binding protein involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus..
• Protein Sequence: MGILFTRMFSSVFGNKEARILVLGLDNAGKTTILYRLQMGEVVSTIPTIGFNVETVQYNNIKFQVWDLGGQTSIRPYWRCYFPNTQAVIYVVDSSDTDRIGVAKEEFHAILEEDELKGAVVLIFANKQDLPGALDDAAVTEALELHKIKSRQWAIFKTCAVKGEGLFEGLDWLSNTLKSGSG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Myristoylation	------MGILFTRMF ------CCCCCHHHH	25.88	16830178

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ARF3_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ARF3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ARF3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GRIP_ARATH	ATGRIP	physical	16236155

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.